SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001600 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001600
Domain Number 1 Region: 95-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000907
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001600   Gene: ENSTGUG00000001551   Transcript: ENSTGUT00000001614
Sequence length 204
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:1216481:1221629:1 gene:ENSTGUG00000001551 transcript:ENSTGUT00000001614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKANRAAAGSSPNATEPQRHEEREPGSREGEPVPGPDYEEDEEEYEEAPPVHQYIVDDLI
RVEPVVKPKPAKRGGEKNAGKSRRKKNRGKNKKKGTPCEMEFKNFCIHGECIYREHLQMV
TCKCHQDFFGERCGEQFMKTQKKNDVADYSKTVLVVVAVLLSSVSFITVLIIVIVQVRKK
CPQYEEKEERKKLRQENRNGHVGV
Download sequence
Identical sequences H0YTI7
ENSTGUP00000001600 59729.ENSTGUP00000001600 ENSTGUP00000001600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]