SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001673 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001673
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Immunoglobulin 5.31e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 108-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000559
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001673   Gene: ENSTGUG00000001621   Transcript: ENSTGUT00000001688
Sequence length 417
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:16084583:16146110:-1 gene:ENSTGUG00000001621 transcript:ENSTGUT00000001688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPPKLKKLKSLNVHVGEKISLKCEATAGNPQPSYKWFKDGKELKKSKDIRIKYGNGKKI
SRLQFNKVKLEDAGEYSCEAENVLGKDTAKGSLNVKSVTTTLSSWSGHARKCNETAKSYC
VNGGVCYYIEGINQLSCKCPIEFTGDRCQHFAMVSFSKHLGFELKEAEELYQKRVLTITG
ICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMA
DYISKNVSATEHVIRRETETTFSGSHSCSPSHHCSTATPTSSQRHESHTWSLERTESLTS
DSQSGIMLSSVGTSKCNSPACVEARARRGATFCIEDQRRPTTQYRDSVDSLRDSPHSERY
VSALTTPARLSPVDFHYSMATQVPTFEITSPNSAHAVSLPPAAPISFRVEEQQPLLR
Download sequence
Identical sequences H0YTQ9
ENSTGUP00000001673 ENSTGUP00000001673 59729.ENSTGUP00000001673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]