SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001683 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001683
Domain Number 1 Region: 36-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000012
Family EGF-type module 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001683   Gene: ENSTGUG00000001634   Transcript: ENSTGUT00000001699
Sequence length 116
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:16362185:16366170:-1 gene:ENSTGUG00000001634 transcript:ENSTGUT00000001699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNCFTVAFLSKPQGLVTPKKKGNGNKRRKGKGLGKKRDPCLRKYKDFCIHGECKYIRELG
APSCICQPGYHGERCHGLLLPVEHPPSAYDHTTALAIVAVVLSSLCLVIIAALLML
Download sequence
Identical sequences H0YTR8
59729.ENSTGUP00000001683 ENSTGUP00000001683 ENSTGUP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]