SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002122 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002122
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily SPOC domain-like 9.42e-45
Family SPOC domain 0.00000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002122   Gene: ENSTGUG00000002062   Transcript: ENSTGUT00000002142
Sequence length 112
Comment pep:novel chromosome:taeGut3.2.4:21:129021:131404:-1 gene:ENSTGUG00000002062 transcript:ENSTGUT00000002142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLEASQLEGVARRMMVESDYCLLLALPCGRDQEDVVSQTESLKAAFISYLQAKQAAGII
NVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIASV
Download sequence
Identical sequences A0A091EJQ4 A0A091MQB5 A0A093G370 A0A093JIN6 H0YV02
ENSTGUP00000002122 59729.ENSTGUP00000002122 ENSTGUP00000002122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]