SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002220 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002220
Domain Number 1 Region: 65-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002220
Domain Number - Region: 479-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000595
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002220   Gene: ENSTGUG00000002149   Transcript: ENSTGUT00000002240
Sequence length 520
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:42992365:43006863:-1 gene:ENSTGUG00000002149 transcript:ENSTGUT00000002240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIDCKLSSWSTWGPCDPCTNQRFRSRHIERFGQFGGKACLEALGDTQTCKTSKACPEEPE
ADCGADFQCSSGRCIKRRLVCNVDNDCGDYSDEDDCESEPRSPCRKHDIDVSEAGRTAGH
GINVLGMQPMASPFDNDFFNGLCERVRDGNTRTYYRKPWNVAVLTYDTKADKTFSSVYYH
DRVKMLREVYIEKQKYFSVDASLKYTPTDGSNKNASEGHFKYDYRKNYAFGSILQSYTER
VRLILLKSFLIFIKQNQTFLHVNGQIQLGRFQIRSRDVRLTDSFLDDLKFLPAEYDKGEY
FKFLEDYGTHYAVSGTVGGRYELVYVLDNYAMSRLGITVEDVKKCLGYHLDANIVYKNIQ
ANFNVDSGKCENIYSREKCNNTGEIHILPSNDNAVIDDVLSLVEGGKIDFSVKIKEMLLR
GAKAVDVEDYIEWAKSLVDAPVVIQQRPSPIHTLVPVKIRDAYLKKQNLERAIEDYITEY
SVCKCEPCKNGGTLVLVDGVCTCLCSSYFKGLACQIPKST
Download sequence
Identical sequences H0YV99
ENSTGUP00000002220 59729.ENSTGUP00000002220 ENSTGUP00000002220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]