SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002493 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002493
Domain Number 1 Region: 100-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000576
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002493
Domain Number - Region: 35-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 167-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 67-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000947
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 136-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002493   Gene: ENSTGUG00000002424   Transcript: ENSTGUT00000002517
Sequence length 200
Comment pep:known chromosome:taeGut3.2.4:2:46206396:46214597:1 gene:ENSTGUG00000002424 transcript:ENSTGUT00000002517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRAGGGPGPLLWLWLWLWLWLWLSALGPGPAAACSPRCRHGGLCLADGSCLCSKGYEG
ERCQHATCYPKCKNGGECLRPGKCRCPPGYGGRYCHKVSCEGGCQNGGECISVNGVVKCL
CASGWTGSRCQEAICPQGCRNNGACVAPGICSCPAGWVGRACHLALCKLPCQHGGKCIAP
NVCRCRLPYSGPQCTKKRKE
Download sequence
Identical sequences H0YW20
59729.ENSTGUP00000002493 XP_002187086.1.42559 ENSTGUP00000002493 ENSTGUP00000002493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]