SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002727 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002727
Domain Number 1 Region: 96-339
Classification Level Classification E-value
Superfamily vWA-like 3.46e-74
Family Integrin A (or I) domain 0.000000706
Further Details:      
 
Domain Number 2 Region: 339-423
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000188
Family Integrin domains 0.002
Further Details:      
 
Domain Number 3 Region: 3-55
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000413
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 542-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Integrin beta EGF-like domains 0.0035
Further Details:      
 
Domain Number 5 Region: 498-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Integrin beta EGF-like domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002727   Gene: ENSTGUG00000002650   Transcript: ENSTGUT00000002755
Sequence length 718
Comment pep:novel chromosome:taeGut3.2.4:2:49759586:49785476:1 gene:ENSTGUG00000002650 transcript:ENSTGUT00000002755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATSNAVTCTKCLALSPECGWCAQEDFMAGTTQKGRCDTVFNLMKRGCQSDLVENPTVHVT
IPSDHETNTQVTPGKVSVQLRPGSEANFMLKVRPLEKYPVDLYYLVDVSASMHNNIEKLN
SVGFALSKKMENISLDFRLGFGSYVDKTVSPYISIHPGRIHNQCSDYNLDCMPPHGYIHV
LSLTDNIAEFRNAVNKQKISGNIDTPEGGFDAMLQAAVCQSHIGWRKEAKRLLLVMTDQT
SHLALDSKLAGIVIPHDGNCHLKDNVYIKATSMEHPSLGQLSEKLIDNNINVIFAVQGSQ
FHWYKDLLPLLPGTVARQIESQAANLNDLVVEAYQKLISEVKIQVDNQIQGLHFNITAIC
PDGSKKTGMEGCKNVGYNKEVLFNVSVTMKGCHTTGGTKYVILKPIGFNETAIVNVQQSC
ACQYGDSTGHRVWADETSDSKQSQCSDNNCSSNRDTLPSEKCRQHQDQPMCSGQGNCIDG
KCFCYKNKLGKVYGKYCEMDDFSCPYHQGNLCSGNGECEGGKCKCFAGWEGDRCECSSQS
AKHCLNSKGQICSGRGKCVCGKCECTDPRSFGRFCEYCPTCNKACEENWNCVQCYHSNNA
SQVILDQCTTSCTYLLHYIDNTSDCFSGRNYFRVFSIIFIVTFLIGLLVVLIIRQIILQG
SSNKIKSSSDYRVSSTKKDKMFLPTVCTRTVTYRRDKPEEINIDISKLRLNETFKCEF
Download sequence
Identical sequences H0YWQ3
59729.ENSTGUP00000002727 ENSTGUP00000002727 ENSTGUP00000002727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]