SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002801 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002801
Domain Number 1 Region: 210-436
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 4.84e-17
Family Soluble quinoprotein glucose dehydrogenase 0.003
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002801
Domain Number - Region: 634-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000199
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002801   Gene: ENSTGUG00000002714   Transcript: ENSTGUT00000002830
Sequence length 696
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:12681923:12749593:-1 gene:ENSTGUG00000002714 transcript:ENSTGUT00000002830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMLPFKLLLVAVVLCFFEGDAKFGESGARRRRCLNGTPPRRLKKRDRRVLSPEAPGGG
EAMCRGLYPRLSCCSRSEAQGLPHAEAKVLSVTNNTECAKLLEEIKCAHCSPHAQNLFHS
PEKGETPEKELMLPYLCKDYCKEFYYTCRGHIPGFLQTAADEFCYYYARKDGGVCFPDFP
RKQVRGPASNSLDHMEEYDKEEEISRKHKHNCFCIQEVVSGLRQPVGAVHCGDGSHRLFI
LEKEGYVKILTPEGDILKEPFLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYASYT
TNQERWAIGPHDHILRVVEYTVSRKNPHQVDMRTARVFLEVAELHRKHLGGQLLFGPDGF
LYIFLGDGMITLDDMEEMDGLSDFTGSVLRLDVNTDLCNVPYSIPRSNPHFNSTNQPPEI
FAHGLHNPGRCAVDRHPIDVNINLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFK
PFSSGSLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPATKQWQEKPLCLGNTGSCR
GFFSGPVLGFGEDELGEIYILSSSKSLTQPHSGKLYKIVDPKRPLVPEECKRTAQPAQIL
TSECSRHCRNGHCTPTGKCCCNPGWEGELCRTAKCDPACRHGGVCVRPNKCLCKKGYLGP
QCEQVDRNIRRVTRAGILDQILDMTSYLLDLTSYIV
Download sequence
Identical sequences H0YWX7
ENSTGUP00000002801 59729.ENSTGUP00000002801 ENSTGUP00000002801 XP_002188973.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]