SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003177 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003177
Domain Number 1 Region: 814-941
Classification Level Classification E-value
Superfamily TNF-like 2.03e-25
Family TNF-like 0.0019
Further Details:      
 
Domain Number 2 Region: 757-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003177   Gene: ENSTGUG00000003084   Transcript: ENSTGUT00000003208
Sequence length 943
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:16774206:16792035:1 gene:ENSTGUG00000003084 transcript:ENSTGUT00000003208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEQQSVIHSNQAESSRTVGERTPGALQDPSGPALFQKMNEKISSQEMKLTFLQKKVDSI
AAAMNDVSKMLSSLEGKINEDKGRDFQSFLKGLKSRSINDLIKDVVGEHFQVFQGEMQES
MAQIFKTMSSMSGDLENTKELVKHLNETQNKFAQEKDSGPTVLDMLELKSHVVQMREEMA
LTCEKPVKALQEKQKSLEVNLDHQQSISVIYYQSLNRTLTEMRDAHEQLLTGEQSSRQNL
PSADQIVEYNVTEYMITLHEKVKRQGMMVLEIYDDLRVQDSKISNLSVALEIQRGSVLGV
CDDMLSESRTDFQAQLAAVRESVSVLNKSLSDMLLPLGNKMDRMNEQINDLCYDMEILQP
LIEQGVPFSLTSEYEQQIQVKELKEKLGNLTVVIDGMSSAMKELFKAQEGLKNESQAYQE
LFESHVNECSMEIEDGLNKTMIVVNSAIDSIQDNYVLKDMLHALRNETEVCCGRTEELDS
LLAFIPQFQQLNESLQSLLYDKRYKINSQVAPSVSDLPYKESVLLDKSILHNFSRVFSIL
NDTSSKVEKQQQDINRLEEKLFDSVEGSKDHEVRLLNVESKISKFLANNCVSLKNTKAAS
TEKEHVVSLQLQALSSRIKALEAKSIRFSNVIPLVNWTAHEAWVLCQDTNKSIQKVNASI
PVLIKLAQPDIPLLQRGLKELIESVLEVKAGTILTNLTQHVDMSMVNAVNNITKLQKQPK
PVIKKPSPAKKASGNASTSLASRSQRNTDNAIDPGQFSACAGSPCQNGGTCVHDRQSFVC
ACRHPFGGVNCSVKLVNDNSLSSYFSKGSYRYAPMVAFFASHTYGMTTPGPIRFNNLDVN
YGASFAPATGKFHVPYLGVYVFEYTIESFSPRASGYLVIDGIDKLTFQAENINNNKYTDR
VITGNALLELNYGQEVWLRLATGSIPAKYPPVTTFSGYLLYRT
Download sequence
Identical sequences H0YY01
ENSTGUP00000003177 ENSTGUP00000003177 59729.ENSTGUP00000003177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]