SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003351 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003351
Domain Number 1 Region: 1923-2144
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.23e-83
Family Fibrinogen C-terminal domain-like 0.00000143
Further Details:      
 
Domain Number 2 Region: 1753-1927
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-24
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 3 Region: 842-1013
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-20
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 4 Region: 1661-1750
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-18
Family Fibronectin type III 0.00000523
Further Details:      
 
Domain Number 5 Region: 572-658
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 662-838
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-16
Family Fibronectin type III 0.0000179
Further Details:      
 
Domain Number 7 Region: 1304-1482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000101
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 8 Region: 1121-1205
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000841
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 9 Region: 1574-1661
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000211
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 10 Region: 1213-1296
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000012
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 11 Region: 1480-1570
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000515
Family Fibronectin type III 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003351
Domain Number - Region: 423-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 392-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 484-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 206-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family Integrin beta EGF-like domains 0.074
Further Details:      
 
Domain Number - Region: 361-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 175-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00245
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 299-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 236-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00323
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 330-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00383
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 516-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00443
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 268-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 454-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003351   Gene: ENSTGUG00000003200   Transcript: ENSTGUT00000003385
Sequence length 2153
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:2775323:2822825:-1 gene:ENSTGUG00000003200 transcript:ENSTGUT00000003385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLIKRIIRQKRETGLNVTLPEDNQPVVFNHVYNIKLPVGSLCSVDLDTASGDADLKAEI
EPVKNYEEHTVNEGNQIVFTHRINIPRRACGCAAAPDIKDLLSRLEELEGLVSSLREQCA
SGAGCCPNSQAAEGRLDTTPYCSGHGNYSIEICGCICEPGWKGPNCSQASCPSDCNDQGK
CVDGLCVCFEGYTGPDCSQELCAQGCGAHGRCVGGQCLCHEGFVGDDCSVPLCPHNCHGR
GRCVDSECVCDEGYTGEDCSELICPNDCFDRGRCVNGTCFCEEGFTGEDCGELTCPNDCH
GNGRCENGLCVCYEGFVGDDCSERRCPNDCHNRGRCVGGRCVCHEGYLGEDCAELRCPND
CNNRGHCENGQCVCHEGFIGEDCGELRCPNDCHNRGRCENGQCVCHEGFTGDDCGQLRCP
SDCHNRGLCVNGQCVCDEGYTGEDCAELRCPNDCHNRGRCVEGHCECDNGFMGDDCGELA
CPNNCHGRGRCENGRCVCHEGFVGEDCRERSCPNDCNNAGRCVDGRCVCEDGYIGDDCSD
GRCTKEKREMFQSLLHMCVCVEAAGTQSARVSPPTELTVTNVTDKTVNLEWKHENLVNEY
LITYVPTSSGGLDMQFTVPGNHTAATIHELEPGVEYFIRVFAILKNKKSIPVSARVATYL
PAPEGLRFKSVRETSVQVEWDPLNFSFDGWELVFHNMKKDDNGDITSSLKRPETSYMQPG
LAPGQQYNVSIHIVKNNTRGPGLSKVITTKLDAPSQVEAKDVTDTTALITWSKPLAEVEG
VELTYGPKDIPGDRTTIDLSEDENQYSIGNLRPHTEYEVTLVSRRGDMESDPVKEIFVTD
LDAPRNLKRVSQTDSSITLEWKNSHANVDNYRIKFAPISGGDHMEITVPKGNQATTRATL
TGLRPGTEYGIGVTAVRNDRESAPATINAGTDLDNPKDLEVSEPTETTLSLRWRRPVAKF
DHYRLVSTSPSGKKSEVEIPVDSTSFLLRGLEPGTEYTISLLAEKGRHKSKPTTVKGSTE
ELPEINHTALVNVGWSGKMRANFCDLTQGSLTHPHIPAHLCWLVAAALGGSVRTRLGVLM
LPLLEAWTHSQCTAHRVCCLEGYYQEILALFSTSEEEPELGELSVSEPGWDGFQLTWTAA
DGAYENFVLQVQESGKPEETRNVTVPGTLSSVNVTGLKANTSYTITLQGVTRGYRSKPLS
LETATGEQPGIAELTVSDITPESFNLSWTASNGDFDAFTIEIIDSNRLLEPMEFNLSGNS
RTAHISGLSPSTDFIVYLSGISRGFRTQAISAAATTANIPRTNKLSVSNATSDSLSLTWE
AQDKAFDHFILEVRNSDFPLDSLVLTMPGDSRHSVVTNLKAATNYTVQLHGVIDGQGGQT
LTAMATTEAEPQLGTLTLTNVTPDSFNLSWTTQDGPFATFVIKIQDSLAAQEAQELTVPG
GTRSAHISGLTDHTAYDIHIRGTTRAGVPTEPLTAFVTTEAMPPLENLTVSDMNPYGFTV
SWMASENAFDNFLVVVVDSGKLLDPQEFLLSGAQRELKLKGLITGIGYEVLLYGFAKGHQ
TKPLSALAVTEAEPEVDNLLVSDATPDGFRLSWTADDGVFNSFVLKIRDTKRKSDPLELI
VPGHERTQDITGLKEGTEYEIELYGIGSGQRSQPVNTVASTAVGSPKGISFSDITENAAT
VSWTPPRSRVENFRISYVPVTGGTPNVVTVEGSKTRTKLVKLVPGVDYNVSVISVKGFEE
SEPVSGILKTALDSPSGLVVVNITDSEALATWQPAIAAVDNYVVSYSSEKEPEVTQLVSG
NTVEYDLKGLQPATEYTLSVRAQKDAQSSETLSTHFTTGLDAPRDLSATEVQSEAAVISW
RPPRAPVTGYLLIYESIDGRVKEVILNPETTSYSLTELSPSTQYTVKLQALSGALRSKTI
QIIFTTTGLLYPYPKDCSQALLNGEATSGLYTIYLNGDKAQPLQVFCDMGEDGGGWIVFL
RRQNGKQDFYKNWNTYVAGFGDPKEEFWIGLENLHKITSQGQYELRVDLRDKGDTAYAVY
DRFSVGDAKSRYRLRVDGYSGTAGDSMTYHNGRSFSTFDKDHDSAITNCALSYKGAFWYK
NCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSSFRLEGRRKRA
Download sequence
Identical sequences H0YYH3
ENSTGUP00000003351 ENSTGUP00000003351 59729.ENSTGUP00000003351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]