SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003422 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003422
Domain Number 1 Region: 441-490,521-562
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000255
Family Fibronectin type III 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003422
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Merozoite surface protein 1 (MSP-1) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003422   Gene: ENSTGUG00000003291   Transcript: ENSTGUT00000003456
Sequence length 715
Comment pep:novel chromosome:taeGut3.2.4:17:3419406:3560885:-1 gene:ENSTGUG00000003291 transcript:ENSTGUT00000003456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRKVDSTGCVCPEELRPMK
DGTGCYDYSKGIDCSDGFNGGCEQLCLQQTLPLPHDPSSSTIFMFCGCVEEYKLAPDGKS
CLMLSDICEGPKCLKSEAKFNDTLFGEMLHGYNNRSQHINQGQVFQMTFRYNNFIKDFPQ
LADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIKYDEAMGYPMVQHWRVRSNLYRVKLS
SITLSAGFANILKILNKDSSREELLSFIQQFGSHYIAEALYGSEFSCTIHFPSKKVQQQL
WLQYQKGEEGDGDGQGHKDQVGNPGVLYPDSVRLHADGALQDLSQRVRVEIRGGSHVPWK
CDLCHHQQLSSPDPEPSPVLVPSISALQEISHPTPDMAAFLWQGALMSSYWCSGKGDVIE
DWCRCDLNAFDENGLPNCSPLPPPVLRLSPNVEPSSTVVSLEWLDVQPAIGTKVSDYVLQ
HKKVDEYTDTDLYTGESLSFAEDLLSGLATSCVAAGRSHGDVPETSLYSVIFKCLEPDGL
YKFTLYAVDTRGRHSELSTVTLRTACPLVDDSKAEEIADKIYNLYNGYTSGKEQQTAYNT
LMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLEKVSSHCSTLLRSA
YIQSRTETMPYLFCRSEEVRPPGMVWYSILKDTKVTCEEKMVSMLRNTYGESKGR
Download sequence
Identical sequences H0YYP3
ENSTGUP00000003422 59729.ENSTGUP00000003422 ENSTGUP00000003422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]