SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004001 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004001
Domain Number 1 Region: 1119-1458
Classification Level Classification E-value
Superfamily NHL repeat 1.52e-23
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1360-1654
Classification Level Classification E-value
Superfamily NHL repeat 0.000000259
Family NHL repeat 0.021
Further Details:      
 
Domain Number 3 Region: 817-896
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000373
Family Carboxypeptidase regulatory domain 0.066
Further Details:      
 
Domain Number 4 Region: 559-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000075
Family Integrin beta EGF-like domains 0.076
Further Details:      
 
Domain Number 5 Region: 627-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004001
Domain Number - Region: 528-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 657-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 493-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 688-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 2026-2124,2216-2276
Classification Level Classification E-value
Superfamily NHL repeat 0.0288
Family NHL repeat 0.014
Further Details:      
 
Domain Number - Region: 463-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004001   Gene: ENSTGUG00000003800   Transcript: ENSTGUT00000004045
Sequence length 2660
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:10441298:10647005:-1 gene:ENSTGUG00000003800 transcript:ENSTGUT00000004045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMEFCETPHILCSGYQTELHGVAEHSYPLEVGSDVDTETDGGTSPDHALRMWMRGIKSEH
SSCLSSRANSALSLTDTDHERKSDGENGNKEMRFCCVITLPHSSFLYMPGSPHNQFTFRP
LPPPPPPPHACTCARKPPPSADTLQRRSMTTRSQPSPAAPTPPTSTQDSVHLHNSWVLNS
NIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTFSRPAFTFSKPYR
CCNWKCTALSATAITVTLALLLTYVIAVHLFGLTWQLQPVEGQLYENGVSKGNKGTEPMD
TTYSPIGGKALDKTEKKVFQKGRAIDTGEVEIGAQVMQTIPPGLFWRFQITIHHPVYLKF
NISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLIKQEPKNSEESQQAPRNLILTSLQ
ETGFIEYMDQGAWHMAFYNDGKKVEQVFVLTTAIEILDDCSTNCNGNGECISGHCHCFPG
FLGPDCAKDSCPVLCSGNGEYEKGHCVCRNGWKGAECDVPEEQCIDPTCFGHGTCIMGIC
ICVPGYKGEICEEEDCLDPMCSGHGVCVQGECHCSTGWGGVNCETALPVCQEQCSGHGTF
LLDTGLCSCEPQWTGPDCSTELCTLDCGSHGVCSRGICQCEEGWVGPTCEERTCHSHCAQ
HGQCKDGKCECSPGWEGDHCTIGKGLLNVSDGCPGLCYGNGRCTLDQNGWHCVCQVGWSG
SGCNVVMEMVCADNLDNDGDGLTDCVDPDCCQQSNCYSSPLCQGSPDPLDLIQHSQPPFS
QHPPRLFYDRIRFLIGKESTHVIPGDVSFESRRACVIRGQVVAIDGTPLVGVNVSFLHHN
EYGYTISRQDGSFDLVAVGGISVTLVFDRSPFISEKRTLWLPWNRFIIVDKVVMQRTESD
TPSCDISSFISPNPIVLPSPLTAFGGSCPERGTVIPELQVVQEEIAIPSSFVKLSYLSSR
TPGYKTLLRIILTHTTIPSGMAKVHLIVAVEGRLVQKWFPAAANLVYTFAWNKTDIYGQK
VSGLAEAMVSVGYEYETCPDFILWEKRTVILQGFEMDASNLGGWSINKHHVLNPQSGIVH
KGNGENMFISQQPPVISTVMGNGHQRSVSCSNCNGLALNSKLFAPVALASGPDGSVYIGD
FNYVRRIFPSGNSIGILELRNRDTRHSTSPAHKYYLAVDPVSESLYLSDTNTRKVYKAKS
LTETKDLAKNADVVAGTGDQCLPFDQSHCGDGGKASEASLNSPRGITVDKHGFIYFVDGT
MIRKIDENGVITTIIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLTVNPLDNSLYVLDNN
IVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAIAVSHSGILYIAETD
ERKINRIQQVTTNGEISVIAGAPSDCDCKIDPNCDCFSGDGGYAKDAKLKAPSSLAVSPD
ATLYVADLGNVRIRAVSRNRAHLSDSNLYEIASPADQELYQFTVNGTHLHTLNLITRDYI
YNFSYSGDGDVATITSSNGNSVHIRRDTSGLPLWVVVPGGQVYWLTISSNGVLKRVYAQG
YNLALMTYPGNTGLLATKSDENGWTTVYEYDSDGHLTNATFPTGEVSSFHSDVEKLTRVE
LDTSNRENVITATNFSATSTIYTLKQDNTQNIYRISPDGSLRVTFASGMEITLNTEPHIL
AGVVSPTLGKCNISLPGEHNSNLIEWRQRREQTKGNISTFERRLRTHNRNLLSIDFDHIT
RTGKIYDDHRKFTLRIMYDQTGRPILWSPISKYNEVNITYSHSGLVTYIQRGTWTEKMEY
DASGNIVSRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSESLQSVTMPSMVRHALQ
TTLSVGYYRNIYTPPDSGAAFIQDLGRDGRLLQTLYPGTGRRVLYKYTKQSRLSEILYDT
TQVTFTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNN
FRVTSMQAMINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFSAN
GQVIEVQYEILKSIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQTVSVN
DKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGNEI
FEYNSNGLLNKAYNKVSGWSVQYCYDGLGRRVASKSSLGQHLQFFYADLSNPIRVTHLYN
HSSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYTPYGEI
YQDTNPDFEVIIGFHGGLYDSLTKLVHLGQRDYDVIAGRWTTPNHRIWKHLNAVPQPFNL
YSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPEIEALGTTYELLQLQTK
TQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYSDGKCSEGVKQLRFAAVPSVFGKG
IKFAIKDGIVTADIIGVANEDSRRIAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEEDL
ALIGSTGGRRILENGVNVTVSQMTSVINGRTRRFADIQLQHGALCFNVRYGTTVEEEKNH
VLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTDGEKQQLLSTGRVQGYDGYFVLSVEQYL
ELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences H0Z0B4
59729.ENSTGUP00000004001 ENSTGUP00000004001 ENSTGUP00000004001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]