SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004353 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004353
Domain Number 1 Region: 528-782
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-49
Family YWTD domain 0.00000434
Further Details:      
 
Domain Number 2 Region: 90-349
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-36
Family YWTD domain 0.0000662
Further Details:      
 
Domain Number 3 Region: 444-521,778-830
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1026-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000457
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 5 Region: 394-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 890-1007
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 7 Region: 41-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000234
Family EGF-type module 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004353
Domain Number - Region: 363-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00915
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004353   Gene: ENSTGUG00000004206   Transcript: ENSTGUT00000004399
Sequence length 1253
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:24116675:24175476:1 gene:ENSTGUG00000004206 transcript:ENSTGUT00000004399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFLVAFLPVVFKIGFVSLSALQHWNCPNGYRLKPENSACVDIDECLEGGLGTCGQTCI
NIPGSYICSCLPGYSLGIDKQSCYVNDPAPFLLFSHGNAIFRIDTEGTNHERLVSDTGPS
TLMDFHYIEEKVYWVDSERRLLQRINLNGKKRERLCYIDKGISGFAIDWINQDILWANRQ
KGTIEATDMNGKKRRVLLRAVGRPTRITIDAEQRLLFMSSDGTVSSIHRASLSGSDMINI
LKTTEKIKAISLDLVDTKLYWIQHDHGKEISHIGSCDYDGGGVRFLRNSVRHQLLAMSLF
AEHLYYSDLKSGMIWRANKYTGNVVVTISLKPSFFPPVEIKIVHPFKQPGAKIDSQDLEK
GICDLNREKCRRRICSPDSRTHRCKCSSGFILSRNKQFCEDINECGFWNHGCTLGCVNIP
GSYYCTCPRGFVLLPDRKTCHELITCTSNDNGCSHGCLQTSKGPVCFCPEGSVLKVDGKS
CTGCTSPDNGGCSQICSSLSPSSWECACFPGYKLQQDRKHCTAIGPKPFLLFANGQDIRQ
ISFDGTDYTSLLDWQMGVVLALDSDPVENKIYFAHTALKWIERANLDGSDREKVVHGAID
TPEGLAVDWINRKLYWTDRGKVCIERSNLNGMQRKMIIWENLSQPRGIAIHPFAKRLFWT
DMGVNPRIDSSSLEGFDRRVVASAGLVWPSGIALDYLADKLYWCDAKQAVVESANLDGSG
RRILAQNDVGHPFAVAVFEDHLWFSDWARPSLVRVDKKTGQNRVRLRGSMLRPSSVVVVH
PLAKPGTNPCLYENGGCHQICENSFGIVHCKCHPGFGKTQDGKSCHALDSSNSTAGSVSV
HKEVMPVPPPETVLQSTRSTGIFKDADNGEKQKIIYFTAEIMVSDEDDCTALECYVNAEC
VLLEDGAMCQCLKGFTRKGKSCYDVDECAVHMDRCNRSVADCINTEGGYVCKCLEGYTGD
GVHCYDIDECKTGSHTCGENMTCTNTEGNFTCSCADHASGTGVGCKSTVPPAAASNEYTT
KAVQGDFVGCPPSYESYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQRRAG
RAKVRSIAITAGAAGLALLLLLLAVLAAYCRRTQNLYKKNLCAEAIRAASSRADESVTPT
GNKSLFAVFKEGNSSLENKAVDLIECETAEPHPACPSESEEEQPVTYDKAAETLAEEEKE
QGRRKEGPAGEKLRQPMAAVKVPPQAPWSIHPNPLPEREPCSLAPDSLLMQPD
Download sequence
Identical sequences H0Z1B5
ENSTGUP00000004353 XP_002195264.2.42559 59729.ENSTGUP00000004353 ENSTGUP00000004353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]