SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004395 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004395
Domain Number 1 Region: 27-349
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-129
Family Bee venom hyaluronidase 0.00000494
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004395
Domain Number - Region: 415-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004395   Gene: ENSTGUG00000004273   Transcript: ENSTGUT00000004441
Sequence length 431
Comment pep:novel chromosome:taeGut3.2.4:1A:21430560:21438094:-1 gene:ENSTGUG00000004273 transcript:ENSTGUT00000004441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVVALLTLADAQLPKPARAPPVLHKPFMVVWNAPTEQCRLRYKVDLDLSVFDIASNINE
TLSGSNVTIFYHTHLGYYPYYSDNGDPVNGGVPQNESLIKHLSKAKSDIDYCIPMKKFQG
LAVIDWENWRPQWDRNWGNKSIYRNKSLEIVRRRHPRWPEDKIRKVAKEEFENAGRSFMN
NTILLAEHMRPNGLWGYYLYPDCYNYDYKEHPQTYTGKCPPIESFRNDLLLWLWKESTAL
YPSIYLDYILKSSPNALKFVHYRVKEAIRVASIARKDYVLPVFVYSRPFYAYTFHVLTER
DLVNTIGESAALGAAGVVLWGSMQYASSKESCLTVKQYIDGPLGHYVINVTSAAKLCSKV
LCKKNGRCIRKNSDSSAYLHLSPSDFKIHDRRSERGPRFQVTGKPSLESIEAMKQRFICQ
CYQGWTGIFCE
Download sequence
Identical sequences H0Z1F7
ENSTGUP00000004395 59729.ENSTGUP00000004395 ENSTGUP00000004395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]