SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004546 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004546
Domain Number 1 Region: 156-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000599
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004546
Domain Number - Region: 129-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0894
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004546   Gene: ENSTGUG00000004415   Transcript: ENSTGUT00000004595
Sequence length 532
Comment pep:novel chromosome:taeGut3.2.4:6:2916266:2933578:-1 gene:ENSTGUG00000004415 transcript:ENSTGUT00000004595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALDPCSAYISLNEPWRNTEHRINSSHGQPTCDSGIDGEWYRFTGMAGDAMPTFCIPENHC
GTHAPVWMNGSHPRQADGIVRRQACASFSGNCCLWNATIEVKACPGGYYVYHLTKPSVCF
HAYCGHFYDICDVVDCQDSCLDTGDCTCSPGTTLGPDGQTCLDENECEQNNGGCSEFCVN
LKNSFRCECGVGRTLGSDGKTCEEIEGCHNNNGGCSHTCIEVEGTYQCECPRGLVLSEDN
HTCQVPVLCKSSSIEVSIPKDLVGGLDLSLINTSCKGVSNGTHVNIHFSLKSCGTVVDVI
NDKIIATNLVTGLPKQTPGSNGDIIVRTSKLLIPVTCEFPRRYTISEGYVPNLKNSPLEI
MSRNQGVFPFTLEIFKDKDFDEPYRGDLPTLKLRDSLYFGIEPLVHVSGLETLVESCFAT
PTSKIDEILKYYLIQDGCVSDDSVKQYTSKDHLAKHFQVPVFKFVGKDNKEVFLHCRILV
CGALDETSRCAQGCRRRVRRSAEQQEEQQDKESVHVSNHILTGGPIRIDFDD
Download sequence
Identical sequences H0Z1V6
ENSTGUP00000004546 ENSTGUP00000004546 59729.ENSTGUP00000004546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]