SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004653 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004653
Domain Number 1 Region: 13-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-40
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 250-315
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000534
Family VWC domain 0.016
Further Details:      
 
Domain Number 3 Region: 462-569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 410-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000272
Family VWC domain 0.031
Further Details:      
 
Domain Number 6 Region: 581-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 667-738
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family VWC domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004653
Domain Number - Region: 381-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 756-786
Classification Level Classification E-value
Superfamily FnI-like domain 0.0324
Family VWC domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004653   Gene: ENSTGUG00000004458   Transcript: ENSTGUT00000004702
Sequence length 794
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:75638:355804:1 gene:ENSTGUG00000004458 transcript:ENSTGUT00000004702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVGFGMDPDLQIDIITELDLVNTTLGVTQVSGLHNASKAFLFQDTEREIHAAPHVSEKL
IQLFRNRSEFTFLATLQQKASTSGVILSIRELEHSYFELESSGLRDEIRYHYRFNGKMRT
EVFPYRLADGQWHRIAVSLSASHLLLHVDCNRIYERVIDPPETNLTPESNLWLGQRNRKH
GFFKGVIQDVKIIFIPNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYA
ETRLSQLEDCHCEKTCQVNGLIYRDKDSWVEDDHCRNCTCKGGAVECRRMSCPPLECPPD
ALPVHVDSQCCKVCKAKCIYGGKVLAEGQRVLTKSCRECRNGVLVKVTETCPPLNCSEKD
HVLPENQCCSVCRGHNFCAEGHRCGENSECKNWNTKATCECKNGYLSVQGDSAYCEDIDE
CAAKMHYCHANTVCVNLPGSYRCDCVAGYVRLDDFSCTEHDECGSGQHRCDENAICTNTI
RGHSCTCKPGYVGNGTTCRAFCEEGCRYGGTCVAPNKCLCPSGFTGSHCEKEADIDECAE
GIIECHTNSRCVNLPGWYHCECRSGFHDNGSYSPAGESCLDIDECALKIHTCWNDSACVN
LAGGFDCLCPSGPSCTGDCPHEGGFKRNGQVWTLREDRCSVCSCKDGRIFCRRTACDCRS
PSADLFCCPECDTRVTSQCLDQTGHRLYRSGDNWTYSCQHCRCLGEVDCWPLQCPTLTCE
YTAISEGECCPHCVSDPCLADNITYDIRKTCPDGFGITRLSGAVWTMVGSPCTTCKCKNG
NVCCSVDLECLNNN
Download sequence
Identical sequences H0Z263
59729.ENSTGUP00000004653 ENSTGUP00000004653 ENSTGUP00000004653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]