SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004777 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004777
Domain Number 1 Region: 23-345
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-125
Family Bee venom hyaluronidase 0.00000799
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004777
Domain Number - Region: 413-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00755
Family EGF-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004777   Gene: ENSTGUG00000004645   Transcript: ENSTGUT00000004826
Sequence length 439
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:3734164:3736246:-1 gene:ENSTGUG00000004645 transcript:ENSTGUT00000004826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLALARQPPEKPSAAPHLTRRPFLVAWNVPTQDCKPRFQVSFDFSIFDLYASPNEGFVG
QNLTIFYKERLGLYPYYTRQGVAVNGGVPQNSSLSEHLARLQEGINKYIRSSTKEGLAII
DWEEWRPVWARNWKPKDIYREASQELVLQRQPTWPPEKVNKQAAFEFESAAQEFMVRTLR
KAKSFRPKQLWGFYLFPDCYNHDYSKNKESYTGQCPDVEKSRNDQLKWLWKESMALYPSI
YLDPLLDSTPNSRKFVRARVMEAMRISQKHHDDYSLPVFVYTRPTYIRKLNVLSQADLIS
TIGESAALGAAGAILWGDAVDTRNRELCQFMKNYLEGDLGRYVVNVTTAAELCSTTLCQG
RGRCLRQDSHADVFLHLNSTNFQLRRRDADHPERPLFWAEGQLSSADILFLRTHFHCHCY
QGWQGSGCQTRAGPRSDAP
Download sequence
Identical sequences H0Z2I5
ENSTGUP00000004777 59729.ENSTGUP00000004777 ENSTGUP00000004777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]