SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004909 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004909
Domain Number 1 Region: 366-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 299-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 3 Region: 422-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 475-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000718
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004909
Domain Number - Region: 89-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0774
Family APC10-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004909   Gene: ENSTGUG00000004776   Transcript: ENSTGUT00000004958
Sequence length 517
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:6241568:6395619:-1 gene:ENSTGUG00000004776 transcript:ENSTGUT00000004958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSLHTLWVTVSSVMQHYPSVWGHYDVCKTQIYTEEGKVWDYMACQPEARDMIKY
VKVTLDPPDITCGDPPETFCAMGNPYMCNNECDASTQELAHPPELMFDLEGRHPSTFWQS
TTWKDYPKPLHVNITLSWNKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVRDLSQHTVLEIICTEEYSTGYMTNSKIIHFEIKDRFAFFAGPRLHNM
ASLYGQLDTTKKLRDFFTITDLRIRLLRPATGEIYVDEQHLARYFYAISDIRVFGRIRCK
CNLHATGCKEENKRLLCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANICIPSI
SSIGNCECFGHSNRCSYIELLNTVICVSCKHNTRGQHCELCRLGYFRNASAELDDENVCI
DCYCNPFGSVHDRCNDRGFCECKEGTSGPKCDKCLPGYIWHSLGCQPNVCDNELLHCQNG
GTCINNVRCQCPPAYTGILCEKLRCEREPGGCGRSSA
Download sequence
Identical sequences H0Z2W7
59729.ENSTGUP00000004909 ENSTGUP00000004909 ENSTGUP00000004909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]