SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005796 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005796
Domain Number 1 Region: 134-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000667
Family Growth factor receptor domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005796
Domain Number - Region: 74-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00728
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005796   Gene: ENSTGUG00000005622   Transcript: ENSTGUT00000005854
Sequence length 676
Comment pep:known_by_projection chromosome:taeGut3.2.4:19:6669035:6672404:-1 gene:ENSTGUG00000005622 transcript:ENSTGUT00000005854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPEQYWGHDCKRSCPCHPNGSCDPVSGHCTCDPNHWGGLCQFPCQCGPHGRCDPLTGLCR
CEPGWWAPNCRKQCQCNPSTSHCDPLTGLCRCLPGWWGRRCSFKCSCNVSPCAQETGKCE
CLPGFWGPACQRRCDCGHGSCSPASGHCTCEPGYQGRSCRDPCPAGKYGSQCVHSCGSCK
RSQPCSPVDGFCLACQPGWNGTLCKDPCAPGFHGDGCLQPCPRCQHGEPCDPQTGSCLRC
DPGWMGPSCNNSCPVGTFGDGCQFLCPECVSGSCDPVTGVCICQAGYWGDSCNDTCPEGY
FGVNCSSPCQCSRGTCDAVQGDCVLNTGLKDHGTLAAAILVPLLLLLLCVACCCCGAGSA
DARDRAAVPDDDVVARMKHHVQGVLANLSALMPCFNLGTSKLPKVTVSHHDVEIPYNPSF
IEPPSSAWVSDSSFSSFDTDNEGPEYSVPPREGIPLLGGAELQDGASPPGQALPDPSAFD
SEGCLAALRLPPHSSIAKAKRPSVSFAEGTKFGAAETPSPSRKPKAPWGPSRLTPPPGDV
AAEPPSERPASDCYENPEPLSKGDESHRPSPRATPGGRRRMVSSTRHVAQRVEALEAAAK
SGSWEAKGKKEHNVTTIYMMVGTAGQDPKAEGSGEGPVQAVLKRLGSLQRGKWAAKEEPK
ARRSMEAIQKPPRRAL
Download sequence
Identical sequences H0Z5F0
59729.ENSTGUP00000005796 ENSTGUP00000005796 ENSTGUP00000005796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]