SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006124 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006124
Domain Number 1 Region: 1457-1505,1586-1697
Classification Level Classification E-value
Superfamily FAS1 domain 5.23e-28
Family FAS1 domain 0.0012
Further Details:      
 
Domain Number 2 Region: 482-621
Classification Level Classification E-value
Superfamily FAS1 domain 6.15e-27
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 3 Region: 1709-1853
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-25
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 2194-2267
Classification Level Classification E-value
Superfamily C-type lectin-like 1.76e-22
Family Link domain 0.0011
Further Details:      
 
Domain Number 5 Region: 898-946,983-1097
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-21
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 6 Region: 362-469
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-16
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 7 Region: 1096-1233
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000183
Family FAS1 domain 0.0048
Further Details:      
 
Domain Number 8 Region: 205-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000234
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006124
Domain Number - Region: 848-887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 
Domain Number - Region: 2091-2127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 1529-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000827
Family Merozoite surface protein 1 (MSP-1) 0.04
Further Details:      
 
Domain Number - Region: 2136-2171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 172-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 246-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 2013-2050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0433
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 83-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0879
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006124   Gene: ENSTGUG00000005918   Transcript: ENSTGUT00000006183
Sequence length 2267
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:5887233:5931084:-1 gene:ENSTGUG00000005918 transcript:ENSTGUT00000006183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSMRCNVKTMFTLNTACTSCAAVPKMLCPRGWLRTTQRPGVRDCRYSVKLGENALSLPG
CHHMCKKEIEEKRCCPGFWGTECYECPGGSENPCNGHGTCLDGIQQNGTCICKEQYSGYA
CQNCRDENRFGPDCQSECDCVHGECNSGVAGKGSCTCYGGYTGPRCDQELPLCKGVTCEA
NSECVVRDGTALCDCKLGYRKQGSTCQAQDPCAPSPCSPFAVCKVLGSRTYECTCKEGFQ
GDGKICQPINPCVDSNGGCPENSTICVYRGPGEATCVCKSGMSRRTPSSECSAYPSDCRQ
YLCDVTATCEINSQGTPSCVCKEGEIGDGRSCYKDLLGEINQHNLRGRFIRKLNVAKKMF
ASGCSTLLTKYGPFTVFVPSLLPILDRMEFNDTTAEQLCRMHVVPGLHLIEDMIKAKTMW
TLSGHQLTFTSQAYIKSFRYQDLPGELYNILQSNLPAANGIIHIVNSLRKKTSTDNLRNP
QKTIGEILASMEIFSRFETILENCGLPAILDGPGPFTVFVPSNDGVDRLRDGRLIYLFTE
GINKLQELVKHHIYTSAAVTVEQLIMMPHIVTMANQILTINISADGRILMDESGIPLKMR
DIVASNGIIHALDGIFIPPSIVPILPHRCNEEQHKIVMGSCVDCEALNNSICPPGSKEME
PTLSPKECVYIHDPQGLNVLKKGCARYCNQTITKPGCCKGFFGPDCMPCPGGFSSPCYGR
GNCSDGIQGNGNCHCFEGFKGTACHICANPNKHGENCDEDCSCVHGVCDNRPGSGGVCQS
WSCKEGYTGKFCDKTSKNCGPSGLSQYCHQHAVCSLNDTARCICMDGYEGDGFSCQPIDL
CSQPERGGCSQNALCTSTGPGTATCQCNVGWTGDGKACVPIDNCMLESRGSCHLNADCVY
VGPGQSKCVCKRGYAGDGHSCDAINPCLMDNGGCHDLATCVPLGGGERSCVCSEGYVGDG
MTCYGDILKVSEEQVSVAFFFGQQKSLFSIPAGANVTVLVPSEAAIKNLSNADKDFWLTP
YTLPFLVRAHFLEGVFTAEKLKKYDRPELPTLNPQTRWQINTTSGVLTIQNASVVVSDIP
ASNGIIHILSKQVLLPPPGEIPPSPPGLQEQLSTVASFSTFQELLEEYQLIGKVESSEQY
TVFVPGNNSIEEYCRAANVTQLDKETVQYHIVLGEKLLPADLRSGVHKNSMLGLSYWLMF
YQNSTQKFVNKIPLDGKSFETRNGILIGVSQVLQVQKNRCTANTTTILKSRCGKCDKGIK
CPSGSVLMVSLGFMNLASCRLRSAGAGTMGCHFTCAKVSLRSVCCPGYYGHMCEMCPGRP
GRWCSGNGECQDGLQGSGECRCQEGFHGTACEMCEVGRYGADCKSECACDNGICNDGLRG
DGSCECFPGWTGPTCQERIKIDLCNNTCHQMANCLNSSTDSQPTCFCSAGYTGNGTHCTE
IDPCTIDHGGCSMHAVCTKVSPGERTCACKEGYAGDGTLCMEIDLCLESNGGCHTNAECI
KTGPKKVACNCLPGYSGDGVSQCNPINLCEQNNGGCSPFGLCKYTGPGTRNCSCSWHSIG
DGFTCRGKVHQVRGLCCTFCVHTLLTQAESIKELSGAGPFTVFVPQTDFIGNTTVFEEWK
SRGLLRDLLRYHMVGCQKLLSSDLEGQESLTSLSGHKIKITVNENSITLNEEAKVVTSDI
VGVNGVIHFIDRILIPSDLVGRNISSKLSQQNVTAVAEAFGYSVYSKLLQDAELLPLLGN
PTHRPFTLLWPTDAAFSALPENRQKFLYRREHRDVLASYLKAHIIRDTKIVAGNVPQVET
IRTMHGSTISFSCSKAHVGEILVGNGDATIIQRHMEFNGGIAYGIDRLLEPPDLGSRCDE
FTLIELQGTTESCGLCGFEPPCPAGSVQRGETRRCYYYGNYLLRNTFLFHHNSLLRRPWP
SHSSWDPLRRHFSSRGPLRQGCRRSCVSSQWVPQCCANHYGRDCRACPGGLEAPCNNRGT
CDDKIGGSGICNCSQEFIGTGCELCAPGRYGPECRECNCTENGVCNGGLHGDGFCFCAEG
WTGERCETRLVVTPTCSPPCHAQAACRAGNLCECDLHYEGDGRTCSVIDMCSQDNGGCAR
HAQCSQSGVNVSCTCAPGYRGDGYICEPIDRCADGRNGDCSEHARCISTGPNERRCECKQ
GYVGDGIQCLEEVVPPTDRCLEDNGQCHREATCTDLHFHDKTMGVFHLQSPRKKYDFTYE
QAQAACAAEGASLATFQQLAAAQQMGFHLCLVGWLDNGTAGYPTAYP
Download sequence
Identical sequences H0Z6C6
ENSTGUP00000006124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]