SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006454 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006454
Domain Number 1 Region: 163-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000385
Family EGF-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006454
Domain Number - Region: 7-48
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000487
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006454   Gene: ENSTGUG00000006290   Transcript: ENSTGUT00000006518
Sequence length 250
Comment pep:novel chromosome:taeGut3.2.4:9:4849461:4852880:-1 gene:ENSTGUG00000006290 transcript:ENSTGUT00000006518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKSRYVPNGKLVSYTVRDLLPGQRYHLSLTAVQNTEQGQVHSEPIHLYVSTLQRDGAPER
RWSQAGHPRVLRNRLPPAFLPELRLLADHNTAEEPSPAPRFTELVDGRGRISARFGTALG
KSITVKTQTEAPVKLENTEVSSWDSLALQLREAKSKTCFAGEGQNCSKNPCRNGGTCTRD
DESYHCACRPGFKGRVCQLACKKVPHWCTRLYSETRSFPVWEGGTCHYLSRRIYKVHQDI
CYKESCESTS
Download sequence
Identical sequences H0Z7A4
ENSTGUP00000006454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]