SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006467 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006467
Domain Number 1 Region: 724-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000025
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 2 Region: 384-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000101
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 617-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000536
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 308-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000124
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 5 Region: 667-736
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 539-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000013
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 348-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.029
Further Details:      
 
Domain Number 9 Region: 268-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 10 Region: 470-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000966
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006467
Domain Number - Region: 504-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0039
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006467   Gene: ENSTGUG00000006290   Transcript: ENSTGUT00000006531
Sequence length 761
Comment pep:novel chromosome:taeGut3.2.4:9:4857947:4868557:-1 gene:ENSTGUG00000006290 transcript:ENSTGUT00000006531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLAGWAVLVALGEWLWAAGEVPLGDFYPFGPAQGDAATRKQDDGGSELRPLSIPFPFF
GAGHTGLYVNNNGIISFLKEVSQFTPVAFPISKDRRVVAAFWADVDNRRAGEIYYRESTE
QPILDRASRDIAQYFPEFPGFSAQWVFIATWYRVTFFGGNSFSPVNTFQIVLITDGKLSF
TIFNYESITWTTGMHASSGGDFAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIADVEMTT
NVGIPGRWVFRIDDAQVQVGGCSNTTSVCLTLRPCLNGGKCIEDCITGNPSYTCSCLAGF
TGKRCHVDVDECLSHPCQNGATCLNGAGRFTCRCPPGFRGNYCEIAESPCENRVCQNGGS
CQVVNRTAACLCQSGYTGEDCQTEVNECESSPCLNGGHCIDLVDNYTCVCLEPFVGQRCE
TGGPRMPGACLSHPCQNAGSCLETEQGYVCECQEGYTGQDCRDQLSEGCECRNGGSCLEG
NITVCQCLPGFFGLLCEFEVTTTPCNMNTQCPDGGYCMEYGGSYLCVCHTNYGTNHTMPS
PCDSEPCLNGGSCKVHDDSYICECPQGFLGMHCEKAKPRLCSTGPCRNGGTCREADGEYH
CTCPYRFTGKHCEIGKPDPCASGPCQNGGTCFHYIGKYKCDCPPGYTGRHCETGRFEEVI
PCLSTEVDCGIPSEVKHAQASFNSTKVGSLAEYQCELGYILSQHNHPRVCRVPGVWSDPP
ECDEIDECQSQPCLNGGQCKDRVSSFLCLCEPGYTGYHCEL
Download sequence
Identical sequences H0Z7B7
59729.ENSTGUP00000006467 ENSTGUP00000006467 ENSTGUP00000006467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]