SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006958 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000006958
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000475
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006958   Gene: ENSTGUG00000006751   Transcript: ENSTGUT00000007027
Sequence length 614
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:15192471:15221056:1 gene:ENSTGUG00000006751 transcript:ENSTGUT00000007027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACGDHAKCENVDGGFNCSCKEGYQPSTGKLQFKPNDGTSCQEIPKAKCELFKDCIAEHIN
RTLARISHLKTPLEKLQEINKNTLGPLLPVEVVSYVEALSYSSWSTMSDSVSDNEALQNT
TINALVNTVNNFLQKDKIAVWEALPVDNQRRSLTKLLHTAEQATLLMSQSFKKTAQLDAN
ASDIALKVFAFDSYHMKHIHPHVYTGGDYIKISPKKRKESSNGTVAVVFLRYSNIGSLLS
SPKNLSSKDPSEQRHTVSSAVIAVAISSNPPTLYELEKITFTLKYAKTADKDIKCAFWNY
SDTMNGNWATEGCELTHSNSTHISCKCNHLTHFAVLMSSGGSVGVTNYSILTRITQLGII
ISLICLSMCIFTFWFFSEIQSTRTTIHKNLCCSLFLAELIFLIGINMNNNKLFCSITAGL
LHYFLLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYVFGYVSPAVVVGISAALGYKYY
GTTEVCWLSTKNNFIWSFIGPACLIILVNLLAFAVIIYKVFRHTAMLKPEVSCYENIRSC
ARGALALLFLLGATWIFGVLHVVQGSVVTAYLFTIFNAFQGMFIFIFLCVLSRKIQEEYY
RLFKNVPCCFGCLR
Download sequence
Identical sequences H0Z8Q5
ENSTGUP00000006958 ENSTGUP00000006958 59729.ENSTGUP00000006958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]