SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007104 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007104
Domain Number 1 Region: 3178-3340
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-42
Family C-type lectin domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 142-257
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-39
Family Link domain 0.0014
Further Details:      
 
Domain Number 3 Region: 256-346
Classification Level Classification E-value
Superfamily C-type lectin-like 2.46e-21
Family Link domain 0.0033
Further Details:      
 
Domain Number 4 Region: 3341-3399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 32-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000393
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 6 Region: 3137-3179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007104   Gene: ENSTGUG00000006883   Transcript: ENSTGUT00000007174
Sequence length 3444
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:70949554:71039568:-1 gene:ENSTGUG00000006883 transcript:ENSTGUT00000007174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIKSILWMYSTLAITYMLPKVKAEKKTVVKGSLSGTSVLPCFFSTTPTISSSYAAEY
LRIKWSKVELDKSGKDAKETTVLVAQNGNIKIGQTYKDRVSVPSHAEETGDASLTFSKLR
ASDAGVYRCDVMYGVEDTQGIVSLAVEGVVFHYRAATSRYTLNFTQAHQTCRDNGAVMAS
PEQLKAAYEDGFEQCDAGWVSDQTVRYPIRHPRVGCFGDKMGKKGVRTYGRRFPNETYDV
YCYVEHMEDEVVHVSAPQKFTFEEARELCEERGVLASVGNLYVAWRNGFDHCCDYGWLAD
GSVRYPASVARPQCGGGLLGVRTLYRYENQTGFPYPDSKFDAYCYEPRKVTTEPPTVEPV
TSLRTESVKLSPAGAPLEPPISETPLTEVPATQTVSLEETTSESEEDTEMTTDVAEEKRE
MEVLMENIPLTTLLPQTVTDSETFTYDTLGRTEYDVSPRLTDTTAPELELDHTYSEAELP
EEQGRSESIEDAFLTSVIFQDSTAVAKSSTGFWEDAGTGDAQRHDADNQTEQIEVGPLRT
ATDSFLQTSRREAARTGTSESLTKENVSHSAHLTNAPTKKSMEAKSDEKLTTVVIPKIWL
TAESAEREGSESMHTAVPGTDSGVATGHVPGSEVPAASETLLDEQAVTTGQFSEVKESMP
WVKFSSATAFDSEASAQGSREDLRDVQPTVAAPVSFSVSAADQTESEAISGSTDALPSFG
GGTMSLIPSSLQTEAPAVLEEQEETNQPEMRTTDVEVPRSTAAIPPCVAAESEGCSAREK
ITQAPPGSGTWLPTDKEEGYMTEESSHPGGVIELATEDGFSGMEPTSSLGHTVEYTVHPG
TPISAATDAAETSREPAETTGDEEMVSADFGQSRDSTSVSHTSSSLDLEMTTVSKIPVEE
SSAPIGFFSSSNVTVLPSAVPTAVGVTEHEGDKTPGTKGTITFPGVTKVDTAVPQKEYDA
SLVPVTVESEVSRDMTITDQTPFDDVFHTEATETTAKHKVFPELSTLDQGLEPRTATLSV
ISAHTHEPEMSPGSEWPQTAVQDETGSAYEEMYPATETSVPAATLTDHGGVLAPEETSTW
LHLTVTPTAGTAPDQDEEVTEVMPITAETEAKTQDSPGTPTREEDDAVSWDSVPPSHTTP
AGHSTVESFTDLTLGASPSQATEGSGMTREPEETRPAVFAATATDKAIILSSMTTPSLGA
TDKIQPTSATKPFVTQKSPRILPGEEEEVTSHDIIIIDESVSPSKATAEDDLPGKMLEPE
IDKEYFTASTATAVARPTAPPQVKEATQALQPQEVSPSTSHPDNDIRLYVIQITGNDTDH
PVNEFLDLFNRHMLPHAIDETHIDADSAQTEPCTSDSVQDSSEYIILDPFFPNYSEFEED
EDCENTTDVTTPPALQFINGKQQVTSAPKSTKAEEARSDQIESVAHSKNVTFSQINETNP
FIINESEASGTMQPSKAGEVIGAFVVTQPTSGAAMLEPVYSGESEVVTTDKSIATTSSHE
QNSRETMTWQGAEESSTKDNKNLLLISSESSGDGSTESDLSTSVLEVVTESRKEDDEKSS
GITSSPDAFTVESSAVTTSLEAVFIPATVDNVVTDLNSEKATPAPGDHCKTTLKLNANSP
VENILETSHTAKPEMSAASFMVLEGSGDLKDSITVTSAVTEEIAVTETLSMQDISLGSGT
ELLREFSVTDSGITSALPRAISTPYSAFDQSPQVTVATNSVSELITGEAFASSPVTEKSI
DDEKEIHTTVYAGHQNSATTTEGNLGLNELGSTTNEVRTVSQEPLRKTVPGTISSEITKV
TTVPLLGEKKLFVNEGSAEEPADIFSGGSTSKVVSIGSPFIDPGSGDIDFTVESTTLTSV
PLRTVTETQTEMYEGKIYITDDASPKDATTEYEKHARTEESAVTVLSTGPESFTEGSGVE
SQMSLDMFSTKNPGEPNMETKPTYTAPSDIKSGSIKEITSHIAPGIETGDSETGEATSSP
GSVVTDNPHDGLVTHGTGSMKAAAESTESKDAKVGSSTASLGKIFLIEHGSGEEFKDDSS
TTKLMSNGPTEEILGGHFSITDQGSGEPDSSTGSFAETAVVPSGRPETWEKDDRQAVSTS
PLDLAFITDPDEQVRTSEQHVTSMGTAGGVRTEEKNVDELTVRTFSTKIPLMEETPSEIS
PKATESSEEETTHPFLKSTQTSHEHLGFLNVPTVSPYLEEKELETEPVKKIPLPFNDDRV
TEPVTIERKYISSPVTVTEQEEELVQNIFPTKDIPRTVLTPKEENPSKDELTGDPLFSGQ
GSGDDLAVFPSVVPFVVQKIKSTSSPETSHPADMGPELSTDMTQDFERGTTPASAEVNEE
VTSAVAELLPETGDPFPTSSASAEDSSKIFLSKEIEDTTHYFVANEEPQEKETDYRRGEN
ETDKPTPTSKAISQEENSHFLIKGGTTPVSVILNGTPSPKTEESPVTSTTKTPGRLLPEG
SGEGSGWVGASDSSSPDMFTHFSIPTVSKVELNVSSSVPGHVYPKVMTTEAPRDGSQTAI
TGLVSLFTEETEVLANPSAAHPKTASSEELTSDTGLYEKIIPMIDDKRSVILNISVYGDI
TLIEERLQTPPEETTIIDMDHSKSMPEDIISVQTIPNPVTQSTYGYDDSMTAEGEKYYST
PRFSIAKEKTLGSGDNLPLTTSSPPRRELVTSGHQPTSGDMDLGSGSDMNFATETLTTME
LSEMGIFLPTVPSLASPQVPHESKPVVTSPTEDTYGPSTSANNRVIADQSETISGFSGMG
QEELADNQPVVPSLTPLVTDKPEEALTTGKLELSVVTTHPTSHLTTVSPIKGAGNRPTVY
TNTKSASAEYEETDTVSFYSVPQTPKSSVTVHLVNGVSEYPEVIIASTSSSSSSSRDSHQ
SNHSSGGIFKEVSSDITATYKPPTTDLDTTESSLLELSPEPLSDSTSTESTPQFGRLLTG
GTEETETPATDLTGEEETAVSGDSPSIRVLPTAFLNFGEIVSTDIPKISITEASSGKVNN
PLQEADRTTERQNPWLLPTTVSDSPNSIENDGFKPGQEEVTMLTSPSQLLDGGTETQAAL
FGQGEITTISSNIAINSTAPGNSPYQNEPSTLSSEEPNTVEAVTSSFSLPEVTNGSDFVI
GTSVGSVEGTAVQIPGQDPCKSSPCLNGGTCYPRGSFYICTCLPGFNGEQCELDIDECQS
NPCRNGATCIDSLNTFTCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDTA
ERECRLQGAHLTSILSHEEQIFVNRIGHDYQWIGLNDKMFERDFRWTDGSPLQYENWRPN
QPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKP
RYEINSLIRYHCKDGFIQRHIPTIRCQGNGRWDMPKITCMNPSTYQRTYSKKYYYKHSSS
GKGTSLNSSKHYHRWIRTWQDSRR
Download sequence
Identical sequences H0Z951
59729.ENSTGUP00000007104 ENSTGUP00000007104 ENSTGUP00000007104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]