SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007419 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007419
Domain Number 1 Region: 110-175
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000114
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 2 Region: 5-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 230-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 262-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000258
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007419   Gene: ENSTGUG00000007208   Transcript: ENSTGUT00000007494
Sequence length 306
Comment pep:novel chromosome:taeGut3.2.4:10:10012509:10029785:-1 gene:ENSTGUG00000007208 transcript:ENSTGUT00000007494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAG
HKFNEVTQKCDDIDECSTIPGICDGGECSNTVSSYFCKCPPGFYTAPDGLKCIDVRPGFC
FSTLSNGRCGNQLPQPLSKMQCCCDSGRCWASAPATAPEMCPIRSTDEYRKLCTVAAMLP
ARPDLPPARPDIIPPPHIPDVYPPPHPEIIYPSRAPPVHPILPVNLTDYCQAFRHLCRNG
RCIPTPGSYRCECNKGFQLHGREECLDIDECERNPCVGGDCVNTQGSYVCQCRVGYQSTA
TRTECR
Download sequence
Identical sequences H0ZA16
59729.ENSTGUP00000007419 ENSTGUP00000007419 ENSTGUP00000007419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]