SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007506 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007506
Domain Number 1 Region: 103-296
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.81e-60
Family Astacin 0.0000905
Further Details:      
 
Domain Number 2 Region: 728-835
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 3 Region: 568-679
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 412-521
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 303-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-35
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 6 Region: 859-952
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-30
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 678-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 523-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000596
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007506   Gene: ENSTGUG00000007264   Transcript: ENSTGUT00000007583
Sequence length 963
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:15494228:15545928:-1 gene:ENSTGUG00000007264 transcript:ENSTGUT00000007583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAFWGDIALDEDDLKLFQIDTTVDLTKHSDGNARHTSEGLEAKKLRTNFCGTKEDLNSLP
LCLADGRQNTTLARSPKGKESEDESGMDAHSSPRVRRATTSRAERIWPGGVIPYVIGGNF
TGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFTYRTCGCCSYVGRRGGGPQAISIGK
NCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQQGQEYNFLKMEAGEVNSLGET
YDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACG
ETLQDSTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIMLNFTSMDLFKSRLCWYDYVEVR
DGYWRKAPLLGRFCGDKIPEPVISTDSRLWIEFRSSSNILGKGFFVVYEAICGGEIHKDA
GQIQSPNYPDDYRPSKECIWKITVSEGFHIGITFQAFEIEWHDACSYDYLEIRDGLTEQS
PLIGHFCGYEKPEDIKSSSNKVWMKFASDATINKAGFAANFFKEMDECSLPDNGGCEQHC
ENTLGSYKCTCEPGYELTADKKSCEAACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVA
PAQYRISLQFEVFELEGNDVCKYDYVEVRSELASDSKLHGKFCGSEKPEVITSYGNNMRL
EFKSDNTVSKKGFKVHYFADKDECSKDNGGCQHECINTFGSYMCQCRNGFVLHENGHDCK
EAGCEHKLSGAEGTMSSPNWPDKYPSRKECTWDISATPGHRVKVTFNEFEIEQHQECAYD
HLEMYDGPNSKSPVLGRFCGSKKPDPVVASTNKMFLRFYSDASVQRRGFQAKHSTECGGL
LKAEVQAKDLYSHAQFGDNNYPGQANCEWVIVAEDGYGVELIFQIFEIEEEADCGYDYME
IYDGYDSTAPRLGRFCGSGPLEEIYSAGDSIMIRFHTDDTINKKGFHAQYISTKFQDALH
MRK
Download sequence
Identical sequences H0ZAA2
ENSTGUP00000007506 59729.ENSTGUP00000007506 ENSTGUP00000007506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]