SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007736 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007736
Domain Number 1 Region: 181-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-78
Family Eukaryotic proteases 0.00000532
Further Details:      
 
Domain Number 2 Region: 17-67
Classification Level Classification E-value
Superfamily GLA-domain 2.19e-18
Family GLA-domain 0.00047
Further Details:      
 
Domain Number 3 Region: 70-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 110-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007736   Gene: ENSTGUG00000007510   Transcript: ENSTGUT00000007817
Sequence length 422
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:7233459:7240820:1 gene:ENSTGUG00000007510 transcript:ENSTGUT00000007817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFYSSRDANQVLRIQKRSNTFLEELKPGSVERECVEEVCDFEEASEIFETREATLDFWSK
YIGNFVTSVSDGDQCEQHLCSNGICKDSIGKFSCICNKGWEGVLCSYEVKYSNCSMDNGG
CEHFCREEPAEQHRLCSCASGYQLKDDHTTCEPVDCFLCQALRDFHEASEQYCLVKLDYT
EGKAGFNIRLIDGTVGRRGGSPWQIMLQNTKGMFLCGGVLIHPAWVLTAAHCLEENKGFR
VKIGKFRFRPEADEQTIRIDKWVIHENYTKKTSDNDIAMLHLAEHVMYYKYALPICLPTR
NLAEQELMRSGKQVVVSGWGSMSEDNQSYAALLRYIEIPIVPHNECAQAMSFHISENMLC
AGSLGDRKDSCRGDSGGPMFTRYKNTWFLVGLVSWGEGCGRKENFGVYTKVSQYLEWIQH
HI
Download sequence
Identical sequences H0ZAX9
ENSTGUP00000007736 59729.ENSTGUP00000007736 ENSTGUP00000007736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]