SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008033 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008033
Domain Number 1 Region: 3166-3430
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 2356-2613
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-48
Family YWTD domain 0.00000415
Further Details:      
 
Domain Number 3 Region: 1404-1665
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-47
Family YWTD domain 0.00000502
Further Details:      
 
Domain Number 4 Region: 366-627
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-46
Family YWTD domain 0.00000719
Further Details:      
 
Domain Number 5 Region: 4022-4293
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-42
Family YWTD domain 0.0000256
Further Details:      
 
Domain Number 6 Region: 681-939
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-42
Family YWTD domain 0.0000239
Further Details:      
 
Domain Number 7 Region: 1713-1978
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-39
Family YWTD domain 0.0000476
Further Details:      
 
Domain Number 8 Region: 2031-2300
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-35
Family YWTD domain 0.0000394
Further Details:      
 
Domain Number 9 Region: 235-251,286-355,625-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 10 Region: 2701-2743
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000353
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 11 Region: 1232-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 12 Region: 3594-3634
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 13 Region: 2824-2863
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 14 Region: 992-1030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 15 Region: 2952-2995
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3111-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 17 Region: 1-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 18 Region: 75-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 2993-3035
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 20 Region: 3892-3929
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 190-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 2869-2906
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 23 Region: 155-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 24 Region: 3477-3513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 1078-1112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 2665-2703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 27 Region: 3553-3595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 28 Region: 3685-3722
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 29 Region: 1193-1231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 30 Region: 3040-3077
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 1115-1153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3763-3800
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3515-3556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 34 Region: 3807-3843
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 1986-2034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.014
Further Details:      
 
Domain Number 36 Region: 38-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 37 Region: 2780-2826
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 38 Region: 1320-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 39 Region: 1357-1397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000029
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 40 Region: 3720-3760
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 41 Region: 2910-2954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 42 Region: 3078-3125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000935
Family EGF-type module 0.013
Further Details:      
 
Domain Number 43 Region: 117-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 44 Region: 3643-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 45 Region: 3850-3887
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 46 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 47 Region: 2749-2785
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 48 Region: 1153-1190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 49 Region: 3974-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 50 Region: 3936-3975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000804
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 51 Region: 2307-2349,2610-2674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000011
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 52 Region: 4348-4379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000119
Family EGF-type module 0.027
Further Details:      
 
Domain Number 53 Region: 1667-1712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000911
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008033
Domain Number - Region: 950-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1038-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00707
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 3434-3466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0186
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008033   Gene: ENSTGUG00000007663   Transcript: ENSTGUT00000008118
Sequence length 4620
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:14178150:14273764:-1 gene:ENSTGUG00000007663 transcript:ENSTGUT00000008118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CERGQFRCGDGRCIPADWRCDGARDCSDDTDEAGCPQPTCEGNQFQCQTDGECIPQSWVC
DDEEDCDDGSDEHQQCPGRTCSSQQFTCSNGQCIPGAYRCDRVEDCTDGTDERVCHYPRC
EQLSCANGACFNASQRCDGKVDCRDSSDEANCTRGCTSTQFQCANGECIPQAFLCDHDDD
CGDRSDENSCTYATCRGNFFTCPSGRCIHQSWVCDGDDDCEDNEDERGCESGHHECYPGE
WACPGSGHCIPIGKVCDGAADCPEGEDETNITAGRHCNVSRCAALSCQYRCHSSPSGGMC
YCPAGYTVSSNDSRTCVDFDDCQMWGVCDQLCEDRVGHHQCHCVEGYFLEHHRHCRANTS
AGVASIIFSNGRDLLIGDLYGRNFRTLVQSQNRGIAVGVDFHFYLHRIFWTDTVQDKVFS
INIDGSDFQEVLNISVDTPENLAVDWINNKLYVVETSVNRIDMVNLDGTNRVTLIAENLG
NPRGIALDPTVGYLFFSDWDSLSGDPKVERAFMDGTNRQDLIKTKLGWPAGITLDIVSKR
LYWVDSRFDYIETVTYDGLQRRTVAHGGSLIPHPYGITLFEHNVYFTDWTKMAVVKANKF
SESNPQVIYHSSLRPYGVTVYHAARQPFVRNPCGSNNGGCEQVCVLSHKTDNDGLGYRCR
CILGFDLHVDGRHCVAVRQFLLFSSQMAVRGIPFNLSTQEDVIIPVTGSPSYFVGIDFSA
QDDTIFFSDTSKDMIYKQKTDGSGREILTANRVESVEDLAFDWISKNLYWTDPRYRSISV
MRLVDKSRRAIVQNLNNPRSIVVHPVIGYIFWTDWFRPAKIMRAWSDGSHALPIVNTTLG
WPNGLAIDWSSLRLYWVDAFFDKIEHSTFDGLDRRTLEHITQMTHPFGLTIFGGYAYFTD
WRLGGIVRVRKSDGGEMTIIRRGISNIMHVKAYDAHSQIGSNYCNRGTNPNGDCSHFCFP
VPNFQRVCGCPYGMKLAPNQLACVEDPSNEPPTLQCGSYSFSCGNGRCVPQYYQCDGVDD
CHDNSDEQNCGSLTTNTCGSSAFCANGQCIGHWHCDTHMTVFDGSDELHCPTQRPSHACT
HFTCDNRRCIPRIWLCDTDNDCGDGSDEKNCTFTGTCEPRQFQCPDHRCIDPFYVCDGDK
DCIDGADEHDCIYNCSATEFCLSGDQCISTYYQCDGVFDCNDHSDEADCPTRPPGMCHQN
EFQCQSDGSCVPHNWECDGHVDCADGSDEHHRCPARTCPPSLFRCDNGNCVYRAWICDGD
NDCRDMSDERDCPTQPFRCPSWQWQCPGHSICVNLSKVCDNSADCPNGADESPLCNQESC
SDNNAGCTHECIQGPFGAQCTCPIGYQLANDSKTCEDINECDPPGFCSQHCYNERGSFRC
YCDEGYILEANGRTCKAAESGNLLLLVTSRNQIVVDNITSQSHSIYSLVRDGTNIVAIDF
DSVTDRIFWSDTTQDKIWSSYQNGTDRKIVFDSGVTVTESIAVDWVGRNLYWTDFVLETI
EVSKMDGSHRTVLISENITNPRGLVLDPRTDAHVMFWTDWGQNPRIEKASMDGNMRTVII
NNKIYWPNGLSIDYPNKLLYFADAYLDYIDFCDYNGNNRRQVVASDLILQHPHGLTVFED
FVYWSDRYTNRVIRANKWHGGNQTVMIYNIHQPLGIVAVHPVKQPHGINSCASSPCSHLC
LLSSSGPLFFSCACPSGWILSPDNRNCMRVEHPFLIAVRDNIIYGISLNPEEKTNDAMVP
IAGVQNGVDVDFDDSEQMIYWVENPGEIHRVRSDGANRTVFASAAVIGAPVGLALDWISA
NLYYSNPGTQSIEVLKLNGDIMYRKTLITNDGTSLGAGTPIGLAVDPARGKLYWTDQGTD
SGVPAKIASANMDGSGIQTLFTGNLDHVEFLTIDIKEQKLYWAVTSTGMIERGNMDGTNR
VTLVVHLSHPWGVAVYGTFLYYTDRDYEVIERVDKATGANKVVLRDNVPRLKSLRVYYRD
NSAGSTNGCSNNIGVCQQLCLPVPGGLFTCACATGFQLNPDNRTCSPYSSFVVVSMLSAI
KGFSLETSDHSEAMVPLAGRGRNALHVDVHMPSGFIYWCDFSSTVSSQNAIRKIKPDGSY
FRNVITNGIGRNGIRGIAIDWVAGNLYFTNAFLTETFIEVLRLNTTYRRVLLKTTIDMPR
HIVVDPKNRYLFWADYGQNPKIERAFLDCTNRTVLVSEGIVTPRGLAIDHSNGYIYWVDD
SLDMIARIQPDGGDVEIVRYGSRYPTPYGITIFGNSMIWVDRNLKKIFQASKQPGNTDQP
TVIRDNINWLRDVTIYSSNFQSRSPLDVNSNPCLDNNGGCSHLCFALPDIQTPKCGCAFG
TLGGDGKRCSISTDDYLIFALENALRSIHLDPENHSPPFRTVSVLRTAVALDFDSINNRI
YFTQSYPSGTGRISYVSIYSGISSPTVVASDLGTPDGIAFDWINNRIYYSDYLNQTISSM
AADGSNRTVIARVPRPRAIVLDPCRGYMYWTDWSSNAKIERATLGGNFRTPIVSTNLVWP
NGLTLDYEEQQLYWADANLQKIERCTLTGTNREVIVSTALHPFAMTVFDQHIYWTDWNTR
SIYRANKYDGSDQIVMIMNLPQRPMDIHVWAKSKQQQCMNPCNQFNGGCSHICAPGPAGA
ECQCPSEGRWYLANNNKHCIVDNGTRCDTGFFTCLNGHCISERWKCDNDNDCGDGSDELE
SVCAFHTCQPTAFTCGNGRCVPYHYRCDHYNDCGDNSDELGCLFRTCDSHTEFTCNNGRC
ISLQYVCNGVNNCYDNGTSDERNCPERTCQSGFTKCQSTNICIPRTYLCDGDNDCGDMSD
ESPTHCVSLTCTNSEFRCTSGRCIPAHWYCDQGIDCADGSDEPASCVPQMRTCSNDQFRC
DDDRCIPATWICDGDNDCGDMSDEDQRHNCANRNCTAAEFTCANNRPPLRRCIPRAWVCD
GDADCSDALDEHQNCTRRSCTENEFTCSNGLCIRNTYRCDRRNDCGDSSDERGCIYEPCQ
QHQFTCQNGRCISKAYICDGDNDCGDESDELEHLCSTPEATCSPHHFKCDNGNCIELVKV
CNRLDDCLDNSDEKGCGVNECSDPSISGCDHDCTDTQTSFYCTCHPGYKLMSDKRTCDDI
DECNETPSVCSQICENTAGSYICKCAPGYIREPDGKSCRQNSNISPYLIFSNRYYLRNLT
ADGQSYSLILQGLRNVVALDFDRVEKRLYWIDVGRNVIERMFLNGTNKETVISDDVPNGE
GIAVDWVGRKLYWVDAYRDCLYVSELDGRFRKKLVDRCVDANNTFCFQYPRAIVVHPKYG
QIYWTDWADRAYIGRAGMDGKEKTVIISTKLEWPNGLTIDYTNDKLYWTDAHLNYIEYSD
LDGHHRHTVYDGTLPHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSERTVLVNTTHRPFD
IHVYHPYRQPFVNNPCGTNNGGCSHLCLIKAGGQGFSCECPDNFMVIQFGNTAHCLPMCS
STQFLCADTERCIPIWWKCDGQRDCRDGSDEPPTCPHRYCPVGQFQCNDGNCTSSHFLCN
TQPDCHDRSDEDPVLCANHQCETHQWQCANKRCIPEAWQCDREDDCGDNSDEDSAHCASR
TCPPGQFKCDNGRCIPQSWKCDVDDDCGDNSDEPFHECMGPAYRCDNHTQFSCRTNYRCI
PLWAVCNGNDDCRDNSDEQGCEEMTCSPSGDFRCDNHRCIPLRWKCDGDNDCGDNSDEHN
CSPRECTESEYRCDNLRCIPSRWICDHDDDCEDNSDERDCDLRTCHPGYFQCDSGHCVAE
RFRCDGNADCLDFSDEAICPTRYPNGTYCPPMLFECKNHVCIQPYWKCDGDNDCGDDSDE
ELHLCLDIACESPFRFRCENNRCIYSHELCNQEDDCGDGSDEKEEHCTEPTPRPCKTEEF
KCSNGNCIPLHYVCDNYDDCGDHFDEIGCNPGTERTCVENICEHNCTNLNEGGFICSCRP
GYKASETDRNSCEDINECEIFGTCTQDCKNSKGSYECFCADGFKSVGDQQGKQCAADGNP
PLLLLPDNVRIRRYNISSEQYSDYIDNQERIQALDYDWDPEGIGLSIVYFSILGQGSEFG
AIKRAYLPTFDSSRNNPTKEVDLNLKYIVNPDGLAVDWVGRHLYWTDAGTNRIEVAKLDG
RYRKWLIFSHLDQPAAIAVNPKRGLMYWTDWGRQPKIECAWMDGQQRQMLVSEDLGWPTG
LSIDYLNNDRIYWSDSKENIIESMKPDGTDRTIVLHGVGSPYSLDVFEGHLYWIAKERGE
VWKKDKFGSGEKVKVLTVNPWLTQVRIYHQHRYNQSVPNPCKDVCSHLCLLRPGGYTCSC
PQGTRFLEGSSTECDAAIESPPTMPPACRCMNGGTCYIDESSLPKCKCSYGYTGNYCEIG
LSKGVPPGTTAVAVLLTVILIIIIGVLAVGGFFNYRRTGSLLPALPKLPSLSSLVKSNEN
GNGVTFRSGADVTMDIGVSGFRGDSAIDRAMQMNENFAVESGKQPITFENPMYTTRDAGA
VTVIQPTLVAAAGSEENENFENPVYSSVISTTGRTSPKETPQKESKWSFFKRKKKQNTNF
ENPIYAEMEKDQQQDTENVPTHSPSLPPKIILKRDQPIAYTATEDTFKDTASLVKEDSVV
Download sequence
Identical sequences H0ZBS5
ENSTGUP00000008033 59729.ENSTGUP00000008033 ENSTGUP00000008033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]