SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008041 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008041
Domain Number 1 Region: 1876-1925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 2 Region: 1817-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000213
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 3 Region: 501-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 1923-1978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 5 Region: 259-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 6 Region: 1395-1443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 318-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 8 Region: 637-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 1485-1533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 10 Region: 1977-2021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 11 Region: 592-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000254
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 12 Region: 734-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000262
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 388-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 14 Region: 684-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 15 Region: 2024-2073
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 16 Region: 454-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 17 Region: 1539-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 18 Region: 547-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 19 Region: 1778-1819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.068
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008041
Domain Number - Region: 787-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00017
Family Laminin-type module 0.077
Further Details:      
 
Domain Number - Region: 1446-1487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008041   Gene: ENSTGUG00000007752   Transcript: ENSTGUT00000008126
Sequence length 2164
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:10757101:10835593:1 gene:ENSTGUG00000007752 transcript:ENSTGUT00000008126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHSLHPPYFNLAEGTRISATATCGEEAAGAGSRRAVEDLYCKLVGGPVAGGDPNQTIQGQ
YCDICSSANSNKAHPITNAIDGTERWWQSPPLSRGLEFNQVNVTLDLGQLFHVAYVLIKF
ANSPRPDLWVLERSTDFGLTYEPWQYFASSKRDCIEKFGQHTVDRITRDDHAICTTEYSR
IVPLENGEIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLQTNTLLGHLMGKALRDP
TVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPSDPYRLQCDCQHHTCGGSCDRCCPGYN
QFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKASRSREDKFEGGGVCIDCQHHTT
GINCERCIPGYYRSPDHPIDSPYVCYRCNCESDFTDGTCEDLTGRCYCKPNFTGEHCQAC
AEGYLNFPHCYPVPAFSQNSTGEQVLPAGQIINCDCYAGGTEGNACRKDPRVGMCVCKPN
FQGTHCDQCAPGHYGPSCQPCQCSGPGQYDGTCDSETGQCLCRTGFEGQSCDQCAPGYFN
YPLCQLCGCSAVGTLPGGCDSAGNCFCRAEFAGPRCEQCSPGHHSYPHCYACSCDSRGAV
DNNCSPAGQCRCHGNFAGHTCNQCALGFYGYPSCTPCQCSREGSLHGTCEQDTGQCSCRP
KVTGLRCDTCVPGAYGFPHCQVGSCNPAGLETADPSLAPGSCACRAYVEGPACDRCKPGY
WNLTPENPYGCLSCKCDTKGTVSGITECRQGDGQCFCKATVCGQFCSACKDGYFNMENAN
YFGCQGCRCDVGGALGPSCEERSGACRCRQSTRGPTCTQPARDHYFPDLHHLKFELEEGT
TPSGRAVRFGYNPLEFEGFSWRGYAQMSSIQPKVVVTLNVTSPDLFRLVFRYVSRGPASV
EGRVSVVEEGKFNVCGNCTEQTKQIVFAPSTEPAFVTVPQNSFGEPFVLNPSTWSLVVEA
QGVLLDYLVLLPSSYYEAPILQLKVTEPCVYQPAPEQATQNCLLYKYLSVEGFPAVAGLD
AVCRLDNRLPRPCPTEQLTPFHPSMATCSGTDVEVQLSLPVAQPGKYVLLVEYANTNALQ
TVGIAVSSPPSATQQGTFTFYPCAYSFLCRGIAVDSQSRMATFELTSEATVRFTSDLADF
FLHKVYLIPAAQFTVELIEPRVHCISVHGTFSSNSSSCVPSRFLKLSQSIIWRAQALPIA
PEVPLAQAVHVAPAGVPVEPAPRPPTAMDPTAELILLQSPQAAVVFNSRIQTLGRYAFIL
HFYQPSHPTFPVEVLINGGRIWQGQTNANFCPHGYGCRSLVVSEDQIILDVTDNDLTVVV
RVPEGKQLWLDYILVVPEDSYTSQYLQEEPLDKSYDFISSCGINSFYINPSTSSRFCRDS
AISLSLFYNNGAQPCRCHEAGARGSQCQPFGGQCPCKSNVIGRECSRCATGYWGFPNCRP
CDCGTRLCDEVTGQCICPPHTLKPECVVCEPQTFGCHPLIGCEDCNCSRPGVQELTEPGC
DPFGGQCPCKSNVIGRECSRCATGYWGFPNCRRENGHQAGTQHSMCEPVTGQQLCKENVE
GLRCDQCRLGTFSLDATNPKGCTKCFCFGATDRCRSAEKHRAEFVDMNGWLLLSSDRQEV
PTALSPREQLVTADLKNLPDAYQELYWVAPNSYLGDQVSSYGGHLRYELHSNPRRGDVFI
PMESRPDVILKGNQMSIMFLEGAYPSLGEAHQGRLQLVEGNFRHTETHNPVSREELMMVL
ANLEQLQIRALFSQLSSSVSLRRVVLEMATDTDTGIPASNVELCFCPANYQGDSCQECAP
GYYRDTKGLFLGKCIPCHCNGHSDQCLPGSGICLNCQHNTEGDHCERCKDGYMGSPSAQE
PLQCVGCPCPLSVASNNFAVGCVHKGSNMQCLCKPGYAGPNCERCAPGYYGNPLVIGSSC
QPCDCSGNTDPNMLFSSCDSLTGACSGCMHHTAGARCQLCAPGYYGDAVLAKNCTQCNCS
PCGTDSCHPQTGQCFCKTGVTGQHCDRCEEGYYGFEGCSGCRRCDCDVGAVGSSCHVQSG
QCSCLPGVSGSRCHQCAPGYWGFGQGGCTKCECRGGSCDPRSGECTCPNGLTGKQCDVCL
HEHEILVANGPDSIKCEVCDSCVLLLLEDLQSIEASFPSIRGQLVTLNASSIAWARLHGL
NGTI
Download sequence
Identical sequences H0ZBT3
59729.ENSTGUP00000008041 ENSTGUP00000008041 ENSTGUP00000008041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]