SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008485 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008485
Domain Number 1 Region: 375-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-25
Family MAM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 117-234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 69-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008485   Gene: ENSTGUG00000008230   Transcript: ENSTGUT00000008576
Sequence length 524
Comment pep:novel chromosome:taeGut3.2.4:1:17923016:17947750:-1 gene:ENSTGUG00000008230 transcript:ENSTGUT00000008576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRARGQLGAVSQPGVCRYGSRLDCCPGWRKNKGHCEATCGHGCKYGECMGPNKCKCFPG
FTGKTCNQDLNECGLKPRPCEHRCMNTHGSYKCYCLNGYMLMPDGTCASSRTCAMVNCQY
GCEEVKGRVQCLCPSGGLQLGPNGRTCIDIDECSTGKAVCSYNRRCVNTFGSFYCKCQLG
YELKYTNGHYNCVDVNECVTNRHRCNLHAECLNTQGSFQCKCKQGYQGSGFDCAVIPEKS
VKEIARSPGTAKDTIKKLLAQKSSVKNHKTIKNAIPEAAVTPPSKMHLQLLDYEVGIDLG
GSYSEEEKETAAAAEEVGEESDEEEKEDFENQIDERSLRGDVFFPKVKEAAAFGPHLAQR
KIPVSRPEQEAISFSVDCSFSRGVCDWKQDADDDFDWNPADRDRGDGYYMAVPAFVGHKN
DMGRLKLLLTDLKPKSSYCLIFSYRLAGEKVGKLRVFLANKKTTPVWEENKGKDEKWRTG
KVEIFQGAETTNSITFESERGKGKTGEIGVDNVMLISGPCPEDT
Download sequence
Identical sequences H0ZD24
ENSTGUP00000008485 ENSTGUP00000008485 59729.ENSTGUP00000008485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]