SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008560 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008560
Domain Number 1 Region: 411-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000255
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 2 Region: 487-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000271
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 3 Region: 323-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 256-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000489
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 451-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 221-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008560   Gene: ENSTGUG00000008311   Transcript: ENSTGUT00000008651
Sequence length 643
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:11216526:11280772:-1 gene:ENSTGUG00000008311 transcript:ENSTGUT00000008651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVSDPCASNPCLHGNCSTSGDGYLCLCNEGFEGTNCEHSPHSLAASQGTEATSPRHSSP
ASSTLEPDIALPRSRATVTLPTWQPKAGQRVVDLKWDEIEITPDVACGNASSNTSAGGRL
ISFEVPQNTSIKIRQDATASLILLWKVTSTGFKQCSLIDGRSVTLLQALGGLVLSEEMLA
LGNNYFIEGFLNDSVTKCIVALRLTVVVKVSTCMPVGSHADNFPCSGKGKCITKPDAAMF
FCECEDAYKGSLCEEFDACQSQPCQNNATCTDVAQKHDRNNFTCSCLPGYTGELCQSEID
HCIQQPCQNGGTCSSHLNGFSCQCPEGFLGTTCEDKIDPCASSPCQNNGTCYADSLAFSC
SCSPGFTGPTCAQLIDFCALNPCAHGICRSVGTSYRCLCIPGYHGLYCEEEYNECLSAPC
QNGATCRDLVNSYECVCLAEYEGRHCELYKDPCVNINCQNGGTCDSEGLNATCMCAPGYA
GEECEIDVNDCDSNPCHHAGTCIDQPGGYTCHCPHGWVGANCEIHLQWKSGHMAESLTNM
PRHSLYIIIGALCVAFVLMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSSAI
ASIRHARFGKKSRPAMYDATPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences H0ZD99
ENSTGUP00000008560 59729.ENSTGUP00000008560 ENSTGUP00000008560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]