SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008736 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008736
Domain Number 1 Region: 503-629
Classification Level Classification E-value
Superfamily TIMP-like 2.75e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.07
Further Details:      
 
Domain Number 2 Region: 333-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 3 Region: 396-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 263-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family Laminin-type module 0.039
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008736
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0191
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008736   Gene: ENSTGUG00000008466   Transcript: ENSTGUT00000008829
Sequence length 629
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:44936913:44982775:-1 gene:ENSTGUG00000008466 transcript:ENSTGUT00000008829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGTRLALLLLGAAAAAAGLGGAAAASSPCEKACNPRMGNLALGRALRTDTSCGRRGAE
RFCSYSEDAERRCRRPSCGRCGGAQPGLAHPPAAMADSPFRLPRTWWQAARDAPRETIRL
DLEAAFYFTHLIMVFKSPRPAAMVLERSQDFGETWKPYKYFAANCSATFGLEDDVRQRGA
ICTSRYSSPFPCTGGEVIFRALSPPYAEEDPYSAEAQAQLKITNLRVRLLERQGCPCLPA
SPAPQPPPSLHYAIYDFIVMGSCFCNGHADHCIPVAGFKPTKAAGVFHVVHGKCMCKHNT
AGSHCQHCAPLYNDQPWQAADGKTGAPKECRSCKCNGHADTCHFDVDVWLASGNRSGGVC
DNCQHNTEGQHCQRCKLGFYRDLRKPFSAPDACKPCSCHPVGSAVLPLGPGTFCDPSTGD
CPCKPGVAGPRCDHCLPGYWGFGPYGCRPCDCARSCDPHTGDCHSSSSDVSWHNEAPPFQ
AVLNESEPTWGWEDEQGFSALRHSGKCECKEQVLGNPKVFCGMKYTYVIKTKILSAHDKG
SHAEVSVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVQTGR
LIVNMKSFVHQWKSTLGRKVLEILKRNCN
Download sequence
Identical sequences H0ZDS4
ENSTGUP00000008736 59729.ENSTGUP00000008736 ENSTGUP00000008736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]