SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009339 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009339
Domain Number 1 Region: 1780-2008
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-32
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 2 Region: 1282-1417
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-31
Family Cadherin 0.0007
Further Details:      
 
Domain Number 3 Region: 2034-2233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-30
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 742-857
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 207-312
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.0026
Further Details:      
 
Domain Number 6 Region: 421-529
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-25
Family Cadherin 0.00086
Further Details:      
 
Domain Number 7 Region: 857-957
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 954-1076
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-24
Family Cadherin 0.0009
Further Details:      
 
Domain Number 9 Region: 1066-1178
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-23
Family Cadherin 0.00038
Further Details:      
 
Domain Number 10 Region: 1174-1300
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-23
Family Cadherin 0.0009
Further Details:      
 
Domain Number 11 Region: 309-435
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-22
Family Cadherin 0.0032
Further Details:      
 
Domain Number 12 Region: 525-644
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-20
Family Cadherin 0.0057
Further Details:      
 
Domain Number 13 Region: 1394-1512
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-17
Family Cadherin 0.01
Further Details:      
 
Domain Number 14 Region: 115-219
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 15 Region: 4-99
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000136
Family Cadherin 0.0019
Further Details:      
 
Domain Number 16 Region: 633-749
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0023
Further Details:      
 
Domain Number 17 Region: 1503-1603
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000214
Family Cadherin 0.031
Further Details:      
 
Domain Number 18 Region: 2278-2317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000908
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009339
Domain Number - Region: 2236-2264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009339   Gene: ENSTGUG00000009048   Transcript: ENSTGUT00000009438
Sequence length 2416
Comment pep:novel chromosome:taeGut3.2.4:11:16075245:16119305:-1 gene:ENSTGUG00000009048 transcript:ENSTGUT00000009438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLTVTDVNDNVPEWAMEPFPFLAVVSPEAAGGTEVYKLLAVDADEGIHGTVEYFLLEGK
CGQDRFEVEKDTGWIKTTGLPLVRDKEYLLTVLAADKLGSRGSPASVSVIAGFRPPQFTN
ISYFVYVPESTPQGEPFLTVTAVSYQKKSLSYSLLTNPGGLFSIDQATGELSLTRSVDYE
GDSHQYLLLVRAEENEGQFSTAAEVLVVITDVNDCAPAFHQSIYSKVGVPETVPMTTALL
QVTATDCDSKENAQLLYYTLSQDFSITSHGTIFPATRLDYERPEHLYEFIIMAVDQGEEP
RTGTATVRIHVSNVNDEAPEFSQTVYRSFVSEDAGPNTLIATVNAVDPDGDGVTYDILSG
NQKGNFVIDPKKGLVRLRASPFPELQGTEYVLNVTATDDNASGGPHPLTSTAQVVVKIDD
VNNNKPVFQKCQYYREHASVLENQPSGTVVLQVEATDADEGTNGIVKYGLMHRDGVLPAF
SIHPDTGVLTTLQVFDREKQREYPITVTATDQAAEPLIGICQINIVILDQNDNDPRFENT
HYEYFLREDTRVGTSFLRVAARDDDYSSNAAITYSIASDEPNYLQIHPTTGWVFVNQPIS
QKTSIIREITATDGGNRSSKVELAVTVTSAENQPPQWERDSYEVVIPENTTRDASILTIK
ATSPLGDPRVTYNLEEGLVPEANMPVRFYLTPNRHDGSASVLVAESLDYETTKSFQLRVR
AQNVAAVPLAAFTTVHVNVTDVNDNVPFFTSSIYEASVTEGADVGTFVTQVSATDLDVGQ
HGEITYSLLHDSGRDYTCFRLDPRTGSIYTTSVFDREEKGSYLLEVKSMDGSESARPGKH
GKPNSDTAYVRVSVSDVNDNQPVFAQSVYEVSVDEDQDVGSTILTVSANDEDEGTNAKLR
YQITAGNTGGVLDVDPETGAIVIAQPLDYEDTKMYEIHLLASDGKWEDYAVIIINIMNKN
DEAPVFSINEYYGSIIEELDLLPVFVLQVMASDPDSGVDGGDLRYSLHGYGAADIFTIDE
KIGSIYSHKRLDREERALWRFIVLATDEGGGGLTGFADVIINVWDINDNAPMFTCMPDDC
SGNVFENSPADTLVMEMAAVDRDDPNVGLNAVLTYRITENVKNEFGTDMFNINPSTGTIH
VAGGLLDRERTESYFLTVEARDGGGLTGTATATVWVADVNDNVPKFTKKLWQAAVPENSA
IDSAVLQVCATDADIGENADLVFSIIGGDPDEKFYIENDKEWQCGTVRLKKKLDFENARE
RQFNLTITVEDLDFSSVAVCLIEVEDSNDHSPAFLSQFIQTNPVFEDVPVGTTVTTVKAT
DKDSDFNGKVIYSIKSDSDPMTQFVVDQFGHVVVASALDREAIQKYALIVQAADQGTPAR
TGSVTVLINLLDINDNGPRFEAPYMPVVWENTLKPEIVHMNHTSKLLHASDPDAEENGPP
FTFSLPPEYQNSLDFSLTDNRNNTATITALRSFDREKQKVFHLPIVITDSGIPAMSSTTT
LTITVGDENDNCHEPGHKEVYVYSYKGKWSTTVLGEVFAPDQDDWDNKTFLSEGKLLKSF
RLNQRTGSLLMVDYTPQGIYNLRVRVSDGVCPDVISTVQVHVRDLENEAVQNSATVRFSG
VTAEEFIRRDEHGKTRHGELKEFLAKLLPAKLSDVIVFSVMGRDGRQTDVRFAVRAGPAY
YRPEKLHAEMAAFKTEMQSALQLNISQIDVDECRSANCSEGCTNHLSVSDIPTVMDTGSV
SFVSLSTSSHGLCSCSARERLHQPCSSYPRSPCLNGGLCVDTLNGYRCLCPASFHGPDCQ
QTKHSFHGNGYAWFRPIRPCFESSLSLEFITVVPDGLLLYSGPLSNPEPGSTENFIAIVE
LSGGIPVLKMSHGSGSVVLQFPSHLNVADKKWHRLEVRTNGQAVRFTLDGCSAAALSEIE
GVGRWLSTEDRTNCQVLGSVPRRARYLNVNPVLQLGGVKESLPYSYPQLLHKHFSGCLRN
FILDTQKVYDLQFPAESLNSFPGCTLTDGSCETMGSSSCGAHGRCLGDWGSFACHCLPGY
HGYRCDKVAKEYRFEAGSHIRYQLPVSVSARRTLLQALVRTRQPHGVIATVLSRARDEHI
TLQVVQGLLVVSYNLGDGNYSVSLPSYHIDNGEWHHITLERNENEFTLRLYEGGGKREIT
KAAGIYKEIVIDPSSLVLGNTYPFNQNKSFQVSLCLAVGCMKDVRFNNYRLPLDTHGKEL
VSVLSAQGIKEGCSSEACRNNPCNQEFICIDLWMMHECSCPAGHMLLENASGRQCVYTAC
AERPCNYGTCVSLSPSTFQCHCPDGYAGRRCEITLAIFHKDTGLSFTSLFAICVCFLALL
VSAAFLWAHWKTRKGLHGGIYHGSAHPEDLEDIRENILNYNEEGGGEQDEDAYDMAELQV
SVQGSPARPALRRLLR
Download sequence
Identical sequences H0ZFH7
ENSTGUP00000009339 59729.ENSTGUP00000009339 ENSTGUP00000009339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]