SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009378 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009378
Domain Number 1 Region: 187-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000261
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 109-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000634
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 67-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009378
Domain Number - Region: 39-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009378   Gene: ENSTGUG00000009102   Transcript: ENSTGUT00000009477
Sequence length 312
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:36931970:36936738:-1 gene:ENSTGUG00000009102 transcript:ENSTGUT00000009477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDDCSERCNLAHGCCDQDGKCRCDPGWEGEYCEECVRMPGCLHGTCHQPWQCICHTGWAG
KFCDKDIHICEHQSPCQNGAQCIYDRDGEYSCLCPEGFHGKDCEMKTGPCEKAGSPCKNG
GQCQDENGFASNFTCRCLAGFVGALCEHDVDDCLMRPCANGATCHDGVNRFSCQCQVGFE
GRFCTININDCASQPCKNGAKCYDRINDYDCLCPDRFTGKTCEISIPEPTCETPGVTQPE
PIRTVVTGQRVANHSEKEPGGGLLKISVKEVVTQRDSGLSEAQLVTVLVFGVLTAVLVLI
TVLLMLRNWQRG
Download sequence
Identical sequences H0ZFL6
ENSTGUP00000009378 ENSTGUP00000009378 59729.ENSTGUP00000009378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]