SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009595 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000009595
Domain Number - Region: 582-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 148-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 453-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00644
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 535-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00953
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 274-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0158
Family Laminin-type module 0.06
Further Details:      
 
Domain Number - Region: 322-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0245
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 61-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 236-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 18-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0816
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 364-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0973
Family Laminin-type module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009595   Gene: ENSTGUG00000009293   Transcript: ENSTGUT00000009698
Sequence length 829
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:18827075:18918305:-1 gene:ENSTGUG00000009293 transcript:ENSTGUT00000009698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEELCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGLVCAQPCPPGTFGINCSQD
CPCHNGGHCDPVTGKCLCTAGYIGDRCQEECPIGTYGFQCAQTCACQNGAKCYHVNGACI
CDPGFKGIHCQERMCPEGFYGLKCNKRCPCNITNTLSCHPLSGECSCKAGWAGLYCNETC
PVGYYGEGCQVPCPCHNGADCDSITGSCICAPGFMGDDCTIPCEAGTYGTNCSSVCNCKN
DGTCSPVDGLCYCKEGWQGVDCSIPCSSGSWGLNCNQTCSCSNGASCRPDDGFCLCSPGW
QGDFCDQPCPDGTYGLNCSERCDCNHADGCDPVTGYCCCLAGWTGIHCDNICSQGRWGPN
CSISCSCENGGSCSPEDGTCDCAPGYRGPLCQRICPPGFYGHHCSQPCPQCVHSNGPCHH
VSGHCDCLPGFSGPLCNQVCPSGKFGKDCAEVCQCTENGTCNPIDGSCQCFPGWIGMDCS
QTCPTGFWGPDCFHSCNCHNGALCSPYDGECRCTHGWTGLYCTQRCPAAFYGKNCANVCQ
CQNGADCDHITGQCTCRTGFTGKQCEQKCSPGTFGYGCKQLCECMNNATCDHVTGTCYCS
PGFKGIRCDQAALMMEELNPYTKISPALGSERHSVGAIIGIIILLLIIMVLLALFVWYRR
KQKEKGHDMPSVSYTPAMRMTNTDYSLSGACGMDRRQNTYIMEKSFKDYMKESVCSSSTC
SLNSSENPYATIKDPPILTCKHSKSSYVEMKSPGHRESPYSEMPTSSTANKNIYEVEPTV
SIVQDSRSRSASYLQNPYDLPRNSHIPGHYDLLPVRHSPTHGPSWDKQS
Download sequence
Identical sequences H0ZG83
59729.ENSTGUP00000009595 ENSTGUP00000009595 ENSTGUP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]