SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009636 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009636
Domain Number 1 Region: 255-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-39
Family Laminin G-like module 0.0000000251
Further Details:      
 
Domain Number 2 Region: 458-665
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Laminin G-like module 0.00000196
Further Details:      
 
Domain Number 3 Region: 43-100
Classification Level Classification E-value
Superfamily GLA-domain 3.53e-20
Family GLA-domain 0.0006
Further Details:      
 
Domain Number 4 Region: 150-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 187-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000995
Family EGF-type module 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009636
Domain Number - Region: 240-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0958
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009636   Gene: ENSTGUG00000009321   Transcript: ENSTGUT00000009739
Sequence length 666
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:26414545:26452110:-1 gene:ENSTGUG00000009321 transcript:ENSTGUT00000009739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHPAAPLGAALLLVLLAADSSQTLLLRAPEAAQFLRQRQRRAYQIFEETKQGHLERECV
EEHCSKEEAREVFENDPETDYFYPKYLACIQKYGSPYTRNPDFLTCVHNLPNQCSPNPCH
KEGTVKCKDLKGDFYCECKHGWQGKKCEKDVDECRTENGGCNQLCLNKLGSYQCSCYSGY
ALKDSKICEDIDECTASADICGEAHCKNLISSYECLCDAGYKYDNVRKTCQDIDECKEKL
CEQTCVNSPGSYTCHCDGRGGVKLSQDMNTCENIIPCVPFAVGRSVKSLHLGRMFSGTPV
IRLRFRRKQLTRLVAEFDFRTFDPEGILFFAGGHQDSTWIVLALRKGRLELQLKYSGIGR
VTSTGPLINHGMWQTISVEELESNLIIKVNRDAVMKIAVSGNLFTLDKGVYHLNLTVGGI
PFKTKDLIVPINPRLDGCMRAWNWLNGDDTSIQETIKMNEKMQCFAVAGRGSFYPGRGFA
VFNLTYMQPSSGNETKTNWEIEVNAVIQPATDTGVLFALVTEEASVPLSLSLIDYHSTKK
VKQQFIIMALENTVVSRLAINLCDKKEHSVDVLVKKDHLSLRVDGKAGESELSISELEDS
LSILESSLQSTKTYVGGLRDVPVTSTPVTASYHGCMTLKLSNTALDLDEALYKHSDITSH
SCPPVQ
Download sequence
Identical sequences H0ZGC4
ENSTGUP00000009636 ENSTGUP00000009636 59729.ENSTGUP00000009636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]