SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009650 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009650
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily CutC-like 1.7e-79
Family CutC-like 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009650   Gene: ENSTGUG00000009354   Transcript: ENSTGUT00000009754
Sequence length 247
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:21180391:21184432:-1 gene:ENSTGUG00000009354 transcript:ENSTGUT00000009754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLMEVCVDSVESAVNAERGGAGRIELCAGLVEGGTTPSMGLLQVVKQCVRVPVFVMIRPR
GGDFLYSDREVEVMKADIRLAKLHGADGLVFGALTEDGRIDTELCTALLAVCRPLPVTFH
RAFDMVHDPLVALETLISLGFERVLTSGCDSSALEGLSLIKRLAEQAKGRIVVVPGGGIT
ERNLQRILEGSTASEFHCSARSARDSGMKFRNPNVAMGASFSAPEYSIKVADVAKVRTLN
AIAKNIL
Download sequence
Identical sequences H0ZGD8
59729.ENSTGUP00000009650 ENSTGUP00000009650 ENSTGUP00000009650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]