SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009753 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009753
Domain Number 1 Region: 399-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.62e-77
Family Eukaryotic proteases 0.0000794
Further Details:      
 
Domain Number 2 Region: 20-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.0000181
Further Details:      
 
Domain Number 3 Region: 181-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-30
Family Spermadhesin, CUB domain 0.0000145
Further Details:      
 
Domain Number 4 Region: 298-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 131-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000636
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009753   Gene: ENSTGUG00000009433   Transcript: ENSTGUT00000009859
Sequence length 729
Comment pep:known chromosome:taeGut3.2.4:9:16898316:16920614:1 gene:ENSTGUG00000009433 transcript:ENSTGUT00000009859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYPLAWPLCALLLCVADAVELTDMFGEIQSPNFPDSYPSDSEMTWNISVPDGFKIKLYFM
HFDLESSYLCEYDYVKIETEDQELATFCGRETTDTEQAPGQQAILSPGPYMGLTFRSDFS
NEERFTGFDAHYTAVDVDECQEKSDEELACDHYCHNYIGGYYCSCRFGYILHSDNRTCKV
ECSDNLYTQRSGVITSADFPSPYPKSSDCLYRIELEEGFFITLNFEDSFDVEDHPEVTCP
YDHIKIKAGQKEFGPFCGEKSPGRIETQTNSVQIRFHSDNSGENRGWKLSYTAIGNPCPL
VQPPINGKIEPSQAKYTFKDQVVISCNTGYKVLKDNVESDSFQIECLKDGTWSNKIPICK
IADCKAPPELEHGFVTFSTRNNLTTYQAAIQYHCQHPYYHMAPNSTATYTCDALGQWRSE
ELGTKLPSCRPVCGRPARPLPGIIKRIIGGRNAEPGFFPWQALIVVEDMSRVPNDKWFGS
GALLSESWVLTAAHVLRSQRRDKTVIPVSKEHVTVYLALHDVRNKMEAVNRTVERIILHE
EFDIQNYNHDIALVKLKEKVTMGKYVMPVCLPQFEHELEGPHPNTLGLVAGWGISNPNIT
VDEIISSGMRTLSDILQYVKLPVVLHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCL
GDSGGAFVIQDPGTRRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVEQKTGSSERW
TFLDPELER
Download sequence
Identical sequences H0ZGP1
ENSTGUP00000009753 ENSTGUP00000009753 59729.ENSTGUP00000009753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]