SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009880 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000009880
Domain Number - Region: 993-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00442
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 712-822
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009880   Gene: ENSTGUG00000009581   Transcript: ENSTGUT00000009987
Sequence length 1066
Comment pep:novel chromosome:taeGut3.2.4:9:17037175:17045406:1 gene:ENSTGUG00000009581 transcript:ENSTGUT00000009987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLYPFGMEGGDQEYVQRMVDFNSPLFKPEIGFPFGKSLQDALYFTDNGQIIFPPTDNHVP
SNPNPPPKGFTGQESLPMVAAFWDDADFSKGVGTTWYQEYSTLSSTQDPVVRDVEAKIEK
YLKIPYVAKWTLKVTWEKAPAYPSQRDDTQTSTYQAVLTTDGNCSFALLLYQDGGMRWDY
TRLAAANVLIGFSSGDGYAQNNELTQKPPATLAEQCCLWGAPPNVRGLWIYRLDSRSRVN
YRLWCLAWLDTEPAPATWNSQLPPCPCSRPQAELDPRYHWSRGAKDSPPGPAAGRGDGCC
AARGSLLEGWQERTWSLPFHTAPAFDWCCRRVGKPLFCAKFAEKRPRVGCEGYVPPTPAG
AFGDPHLTTLDGLTYTFNGLGDFVLLLASDAQTSFILHGRTAQTGMAQATNFVAFAAQYI
SNTTTTLIIVEWTLGSQDDIQVLLNNKIIQFSYSQDLGDGIYYSPGVLLVNTSSVTAVFG
GTISVSVLATSGILSVVCSLPNWYCNSTRGLLGVWDHDPTDDFQMPNGTSIPVNSSEEEI
YSYGMTWAVREHSLFTQPLGSPALNFTPFFLSRLRQENESQYELAALQCHGSKECIYDSL
STGNLALGLATQSLAADFQQRKIALNPFPPVITGDASITAFRTEKGQKAITCLGGGCTLI
PHLSPELNISENGTLVWEPRGAAPFTVSLEAVGSNNISALLQLRFTLCRCSRSQDCDYSN
TVILRESSLQLAACRCESGYSGAFCQDPPDPCSQGCFPGVGCDPFSGCGPCPAGLTGDGE
HCSAAEDACGYHSCPEGYCSNGGHCHLHPITCAPTCTCPPAFTDQHCLVAGGDFQPLPTS
GLPRRSIQMRIKTLQNTTAEEVNSTVSAILGSLEVKAFQRNTNITQISPLFSLQDRQRWL
HFVVVSEFAYESRGTIIRFLNEELPTAITNAFNARRGRRAAGTGLRFQRLHRDNITDLVK
LTVDELRDYFRCTLYGYKGYRLHYVGIIGFVCISPCKMGYCQHGGQCQHLPEGPMCSCLP
FSIYSPAGLQCQWLAISLAAFLGILLGALALLCLLFATACLALHLC
Download sequence
Identical sequences H0ZH16
59729.ENSTGUP00000009880 ENSTGUP00000009880 ENSTGUP00000009880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]