SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010303 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010303
Domain Number 1 Region: 270-468
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.9e-49
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 485-559
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 5.63e-17
Family Blood coagulation inhibitor (disintegrin) 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010303
Domain Number - Region: 716-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0569
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010303   Gene: ENSTGUG00000009963   Transcript: ENSTGUT00000010412
Sequence length 807
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:20945116:21012186:1 gene:ENSTGUG00000009963 transcript:ENSTGUT00000010412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAVWLRRPRRPALLPLLGRLVSLLLLLHGSSCPRARAAAGLHWNETASGIEEVLADEDS
TFQQSNSSNSKNNSYSNAIQKEITLPSRLIYYINRDSETPYHILDTRARHQQKHDKAVHL
AQASFQIEAFHSKFILDLTLNNDLLSSNYMEIHYEDGKPKFSKGGEHCYYHGNIRGVKDS
KVALSTCNGLHGMFEDSTYLYLIEPMDLTHTAESKSRPHIIQRTYGTQASKQLRDLEADS
SSEWPFLSELQWLRRRRRKRALSRGVFEEMKYLELMIVNDHKMFKRHRSSTAYTNNFAKS
VVNLVDAIYKEQLNTRVVLVAVETWTDRDRINIRPDPLQMLHDFSKYRQHYIKQHADAVH
LLSNVTFHYKRSSLSYFGGVCSVARGVGVNEYGLPLPMAQELAQSLAQNLGIQWEPAARK
PKECDCTESWGGCIMEETGVYHSRKFSKCSIAEYKEFLLRGGGACLFNRPTKLFEATECG
NGYVEAGEECDCGFRMECYADCCKKCSLSNGAHCSDGPCCNTSCLFFPRGYDCRYAVNEC
DIAEFCTGDSGQCPPNLHKQDGYACDSNQGRCYNGECKTRDNQCKYIWGSTTESSGSDKF
CYEKLNTEGTTKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRVPRVGQVQGEIIPNSFYH
QGRIVDCSGAHVLLDDDTDLGYVEDGAPCGPQMMCLDKKCLPIQSLNISSCPIGSNGKVC
SGHGVCSNEATCICNSSWAGTDCSIDDPVRDTGGKKDEGPKGPSATNLIIGSIAGAILVA
AIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences H0ZI86
ENSTGUP00000010303 ENSTGUP00000010303 59729.ENSTGUP00000010303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]