SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010384 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010384
Domain Number 1 Region: 355-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-16
Family ABC transporter ATPase domain-like 0.065
Further Details:      
 
Domain Number 2 Region: 186-295
Classification Level Classification E-value
Superfamily DNA primase core 0.0000262
Family Primase fragment of primase-helicase protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010384   Gene: ENSTGUG00000010066   Transcript: ENSTGUT00000010494
Sequence length 492
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:22511790:22519226:-1 gene:ENSTGUG00000010066 transcript:ENSTGUT00000010494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVLPSPDGPAPSVSITEIRQYLRAQDIPFHDGYSCLHAPSLFTGDRGDQPLSANAPFTLF
IDKTTGSFLCTATLAEGTWQDFQANVEMRHRGVTPIPPASSEETEEEMRQAREDARCIWE
RALPLWELLDEKETKETKALFGISQVTDATLKRFGVRYLRTARSLVFPWFSPQDASLKGL
KLLRVEKKGGTITYVEETLPRFDSYRNLFGLPLIGRRDTELVLTGWELDALALHQAAGVA
SLALPRGASCLPPTLLPYLEQFKRITLWLGEDLRSWEAAKLFARKLSLKRCSLVRPGNLQ
PRPLEALNQGLNVTKILRSALLASHKSIISFRQLREEVFGELVNTEQVSGVKWARFPELN
KLLKGHRRGELTIFTGPTGSGKTTFISEYALDLCMQGVCTLWGSFEINNVRLAKIMLTQF
ARRRLEDQLELYDEWADRFEELPLYFMTFHGQQSIKTVIDTMQHAVYMYDITHVVVDNLQ
FMMGHEHLSMDR
Download sequence
Identical sequences H0ZIG7
ENSTGUP00000010384 59729.ENSTGUP00000010384 ENSTGUP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]