SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010429 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010429
Domain Number 1 Region: 415-721
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.2e-54
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 235-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010429   Gene: ENSTGUG00000010108   Transcript: ENSTGUT00000010539
Sequence length 721
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:17154812:17211039:-1 gene:ENSTGUG00000010108 transcript:ENSTGUT00000010539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAPWTLVGLTLLQLLLISCLPREYTVINENCPGAEWNIMCRECCEYDQIECICPGQKE
RVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYIKGIYCAECRAGW
YGGDCMRCGQVLRASRGQILLEGYPLNARCEWTIHVQAGFNIELRFSMLSLEFDYMCQYD
YVEIRDGDNLDSQIIKKFCGNERPPPIRSTGSSLHVLFQSDGSKNFDGFHAVFEEITACS
SSPCLHDGTCILDKSSTYKCACLAGYTGNRCENFLEEKNCSDPGGPLNGYRRVVEDTGLL
NGRYAKIGTVIAFFCNNSYVLSGNEQRTCQDDGEWSGKQPICIKACREPKISDLVRQKVL
PMQVQSRETPLHQLYSSAFSKQKLQIYPTKKPALPFGELPPGYQHLHTQLQYECVSPFYR
RLGSSRRTCLKTGKWSGRAPVCIPICGKAENITLTKAMSSMRWPWQAAIYRTANGVKENS
LRKGSWILICSGALVNERTVVVAAHCVTDLGKTIVLKTAELKVVLGKFYRDDDRDEKTIQ
NLRISAIIVHPNYDPILLDSDIAVIKLLDKARISSRVQPICLSSSHDLTSSTEDLKIMVT
GWKVLADIKDLGYKNDTIRMGVVQMVDSLLCEQQYEDNGIQVSITDNMFCAKQDHTAFSN
ICPAETGGIAAITLPGKASPELRWHLMGLVSWGYDKTCSLELYSGYTKALPFKDWIEKNM
K
Download sequence
Identical sequences H0ZIL2
59729.ENSTGUP00000010429 ENSTGUP00000010429 XP_002199669.1.42559 ENSTGUP00000010429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]