SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010839 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010839
Domain Number 1 Region: 3105-3288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 2 Region: 2946-3098
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-31
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2555-2699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-17
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 4 Region: 2716-2858
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-16
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 5 Region: 2342-2533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000726
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 1311-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 1221-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 8 Region: 1698-1746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.063
Further Details:      
 
Domain Number 9 Region: 311-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 10 Region: 448-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 11 Region: 1644-1690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 12 Region: 252-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 13 Region: 587-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1360-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 493-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 16 Region: 381-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 17 Region: 541-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 18 Region: 640-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010839
Domain Number - Region: 1272-1313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 1607-1646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 1786-1895
Classification Level Classification E-value
Superfamily Tropomyosin 0.0641
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 64-140
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0918
Family APC10-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010839   Gene: ENSTGUG00000010481   Transcript: ENSTGUT00000010952
Sequence length 3289
Comment pep:novel chromosome:taeGut3.2.4:2:108864793:108972418:1 gene:ENSTGUG00000010481 transcript:ENSTGUT00000010952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHPPYFNLAAAARIWATATCGEAAGGGGRPQLFCKLVGGPAAAPLGRAIQGQFCDYCNA
ADPSKAHPITNAIDGTESWWQSPPLSMGLKYNEVNVTLDLGQLFHVAYILIKFANSPRPD
LWVLERSVDFGKTYAPWQYFAYSRADCLERFGKEANLPVRRDSDVLCTTEYSRILPLENG
EIVVSLVNGRPGAKNFTYSPGLQEFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYY
YSIKDISIGGRCVCHGHAEVCSPKSDENQYQFQCECQHNTCGETCDHCCPGYNQKQWQPA
TAGSTNICEPCNCHGHATDCFYDADVDQQRASLNIHGHYEGGGVCINCQHNTAGINCEKC
AKGYYRPYGVPVRAPDGCIPCSCNLEHADGCEEGSGRCFCKQNFQGDHCERCADGFYGYP
FCVYTPVYPFTSSIPSDGVAGDIIGKLCKCNLLGTQPEVCDFLGRCLCRSEVAGLQCDSC
QPGHHSFPACQACSCDGVGSLGNTCGPGGQCLCRGNYAGLRCDQCAPGYYSYPNCFRVNS
ECDPAGSIGSHSGFCQCLQHVEGPTCSKCKPLYWNLAKENPEGCTACQCDVSGTLSGVAE
CQQENGHCYCKSNVCGESCDTCEAGYYALEKKNYFGCQGCRCDVGGSLSPACSQPWGSCQ
CRAHVVGTTCREPEKNYFFPDLHHMKFEIEDGTTVQGGKIRFGYDPQEFPSFSWRGYAQM
SSIQNEVRITLNVEKSNLYLFRIILRYINPGGETLSARISACQSQPGAGAAQTKEFVFPP
SKEPTFITIPGKSSTEPFLLAPGMWTVSIMAEEVLLDYLVLLPSDYYEASLLQISVTEPC
THPRPASAEHCLLYQHLPLGRFSCVLGSEAVQFRHGGESRRIPVRQPAPSQPVMAHITGR
EVNLEMTINVPQVGRYVLVFEYANEEDQIDTAEVTVHSPGPVTEGRVRIYSCKYSFLCRS
VVVDDRNRVAAYDLLADTKIRLKASSSNFLLHKVCIISAEEFSPEYVDPKVQCIAAYRSN
SDGSAACIPSVFDTPPGALVLDAFKDGKISEVEENILHDPLREKSPKHQITLSGRVPHMG
RYVFVVHFYQPAHPVFSVQVHVNAGHMWSGTFNASFCPHTSGCRVQVVAANQIEFDISEP
MVSVTVMIPDGRMLVLENILVVPADTYSYKILDKKTVDKSFDFISQCGGNSFYIDPERSS
AFCKESARSLVAFYNNGALPCACHSAGAASPACSPLGGQCVCRPNVIGRQCSRCQTGYYG
FPFCKLCNCGQRLCDDMTGKCICPPRTVKPKCEVCEKYYFSYHPLAGCKSCNCSEKGIVD
VASPECDKTSGQCKCKPGIKGRQCDQCAPGTYGFPNCVPCSCNRDGTEPDVCDPQTGICL
CKENVEGATCDTCRRGSFYLNPSNPRGCTPCFCFGATSSCRSTDRRRTKFVDMRNWRLEA
VDERMDIPVTFNPVSNSVVADVQELPASVHNLYWKAPPSYLGEKLSSYGGFLSYQVKSFG
LPSEGMVLLDKKPDIRLTGKQMEVVYMDPNNPLPDRQYYGRVQLVEGSFRHAVSGKLVSR
EELMTILSRLDGLHIRALYFTETQRLTLGEVGLEEATSEGSGSIAHSVEVCACPPEYAGD
SCQECSIGFYRENKGIFAGRCVPCNCNGNSNRCQDGTGKCIDCQYNTAGEKCEHCKDGYF
GDATQGSCRECPCPYTNRFAAGCVANGEEIQCLCKEGYTGARCERCAPGYFGNPQKYGGF
CQKCNCNNNGQLASCDHLTGECFNNEPKDVDPNEDCDSCDSCVITLLKDLSTIGDELQLI
KSQLQNVHASSHTLEQMRDLETRIKDLKVLLNNYRSVVHNQGSKVDELETEFIKLNRDVD
ALQEKAEMNYKEAERLFNNFGQTHKKGKDLVSQIQIVVNNIRVLLEQVAGTNAEGNNLPL
GDASEELAEAQRMMAEMRSRSFGQLQAEAEKERTEAQQLLARIKNELQKYHQENRGLIKV
VRDALNEYESKITDLREALNDATAQIKQAEGLNKDNTVLLEDIKKRIEETNVQQNGVLNI
LSSARSSLTQAKSVLGLLQESKEEYESLAAQLDGARKDMNEKVANLSSASKEPLVVRAEE
HAKSLQDLAKQLEEIKNSARRDELVGCAVEASTAYDNIIGAIKAAEEAASQAGKAADLAL
STVKREDLSGKAARLKTESSALTDQAQETKRTLQAIGPNLEDLKQRLDVTDGKTNALKID
LVTAQNNLNGINRGDIDSIITSARSMAENANSVTNSVLGELVPIEAEVERIRSNYGSTQS
ASFNKALMEANNSVKNLTNQLPDLFSKIKSINQQLMPISNISENINRIRELIQQARDAAN
KVAIPMRFNGSSGVEVRPPSNLEDLKGYTSLSLFIQRPQPRSDTQQRANRFVLYLGNKNA
SKDYIGMAVKDGYLTCVYNLGGGDGEVRVQSLVTQSDTEEAVMDQVTFERIYQYAKLRYI
KAATSISPDYESPRSASSGDSDMLLNLDPSSVVFYVGGYPPDFRPPDNLNYPRYEGCIEL
NSLNEHIVSLYNFKRTFNLNTTEVQPCRRYKEETDQSYFEGTGYASVTAGERSGERVRYE
QTIETTADEGIVFFAANGDQFISVLIRNGHTVFRYKLHSETPEEVEAKKTVNDGTYQQVF
FAVAWSAARNLYALPKFCVKANIQVFNFTEYYLGGVPSFLREQFNISTPPFRGCMKNVKN
PSTASVVFDKTFGVSKKCSDDWKLVRSAAFSKDGTLSLSAADFPFPKDFQVGFGFQTTAS
AGTLLNYNLRPDVLSIFLSPGSVTAKIRDKEIKLEKIYEDGSMHYVTVIKTGNRIHMMVD
DESKAIDSPRSSSSQESNRPIKFGGDNFEGCISNIFIERAGQLPEVQNLVANTGKTGVSL
GACQEYENLEPMLLQEFKNPLRLKMLKVCFLLLLSIISGTEIQILGKTVYCLAPLHDSSE
AYLLGSNPNSFISYMFSPLLSTDRLHFSVDVRTRSSRGLIVFMEESSEDSYMALHISKGR
FVFSLGSGEKQIKVKTNIKYNDGQWHTVVFSTDGKNARLVVDGLRSQHRKLVTNSAINIR
PPVYVGGLPPLKRQNMPMKSFKGCLRNFKMNGKAMNTPQQKNGVLPCLDVPMDTGIYFFN
EGGYITIGNLLMSVDFKIVFTIRPRSSTGVLLHAGSKQDNYLTVYMKGGKVIAAGNSDAG
EFQASVIPKKPLSDGRWHTIAVSQKENTVQLEVGTQSNYTTVLQPSPPRRVYQPLYFGKI
PANLDTLWLPVEDPFFGCLRNITINDKHVSTRRISEIHGSVNLHGCPEK
Download sequence
Identical sequences H0ZJS0
ENSTGUP00000010839 ENSTGUP00000010839 59729.ENSTGUP00000010839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]