SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011110 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011110
Domain Number 1 Region: 421-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000293
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 305-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 253-388
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 4 Region: 461-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000947
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 383-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000265
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011110   Gene: ENSTGUG00000010777   Transcript: ENSTGUT00000011230
Sequence length 668
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:23234323:23241869:1 gene:ENSTGUG00000010777 transcript:ENSTGUT00000011230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVQRVSGSGVFQLELHEFVNSHASLASGKPCFPHCRTFFRVCLKHFQTVVSPGSCTFGSI
ITPVLGINSFSIKDTERFDSPIKLPFNFTWPGTFSLIIQAWHAPDNYLPEGSRPPPQEWL
ISQMSIQRSLSVGEDWLQDVHQGPLTKLRYSYRVVCSENYYGESCSRLCKRRDDRFGHYV
CAADGSLACLPGWAGEYCTDPICLAGCTEQNGYCNKPGECICRPGWQGRYCDECIPHIGC
RHGTCKTQWQCICDEGWGGLFCDQDLNYCTHHRPCKNGATCMNTGQGSYTCACKPGFTGV
DCEHEISECDSNPCRNGGSCTDMENSYHCLCPPGYYGTHCEHSALTCIDSPCFNGGTCLE
KEQGASYTCVCPFGFTGSNCEKKVDRCTSNPCANDGSCFYLGQIRVCRCRAGFSGQKCEI
NINDCARNPCSNGGTCHDLINDYTCTCMPGYSGRNCDIKTRDECASGPCENGGTCYSGLY
SANFVCYCPSGFMGNRCELPVYSVPVTLPPKPVPWIAISMGVGLVALLILFCMIAMVIRQ
MRMHPEQELETMNNLSDFQKDNLIPASQLKNTNKNKDLEVDCGLEKSNYKPKNHKLDYNL
VKDLTSRGTAEDKYYKSEKCLGEKSPLRLHSEKPECRISTICSPRDSMYQSVFVITEERN
ECIIATEV
Download sequence
Identical sequences H0ZKJ0
ENSTGUP00000011110 ENSTGUP00000011110 59729.ENSTGUP00000011110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]