SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011351 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011351
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily dUTPase-like 4.32e-17
Family dUTPase-like 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011351
Domain Number - Region: 113-160
Classification Level Classification E-value
Superfamily Acid proteases 0.000368
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011351   Gene: ENSTGUG00000011014   Transcript: ENSTGUT00000011475
Sequence length 160
Comment pep:novel chromosome:taeGut3.2.4:9:23408639:23409118:-1 gene:ENSTGUG00000011014 transcript:ENSTGUT00000011475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSLSLDLATTIDINLIDMKPTRIPTMIKGPVMHREKPCGALLLGRSSAGLKGLSILPGV
IDADFTGEILIVAMTFYPPLIIPAGSKIAQLVPTLQLTEAASCIMHQLRGPDGFESTGGM
ALLCLPMEERPKAPVLLENGQQRLQLSTVLDTGADITIIS
Download sequence
Identical sequences H0ZL78
ENSTGUP00000011351 59729.ENSTGUP00000011351 ENSTGUP00000011351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]