SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011838 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000011838
Domain Number - Region: 117-244
Classification Level Classification E-value
Superfamily SPOC domain-like 0.00471
Family Ku80 subunit middle domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011838   Gene: ENSTGUG00000011484   Transcript: ENSTGUT00000011967
Sequence length 975
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:56997683:57171197:1 gene:ENSTGUG00000011484 transcript:ENSTGUT00000011967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEEVLQGADHYKSEIERLTRELSETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGL
KQELEQLKEAFGQSFSVHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAV
VTNVQAENERLTAIVQDLKENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITL
QKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNER
EQKNNLRKELSQYINLNDSMYNNHINISVDGLKFSEDGGEPNNDDKMNGHIHGPLVKLNG
DYRTPTSRKGESLHPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQESQTQLEHTK
GALTEQHERVHRLTEHVNAMRGLQSNKELKVELDCEKGRDSGEEAHDYEVDINGLEILEC
KYKVAVTEVIDLKAEIKALKEKYNNYVENYTEEKAKYESRIQTYDEQVTSLEKSTKESQE
KMVHMEKELQRMTSIANENHNTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYY
RQSRVTRSGSLKGPDDPRGLLSPRLPWGGGAWPVKPRPPPEPTKEAADPGKEQSPTKTLS
ISPVITAPLSSPVSDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAAREL
APMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAM
VTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNSL
LRMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSEEASATVPSIDTFLLHS
QGPQQPNLLVSSGTQRKRLFSPSLCDQSHPRTSGTYLQKLLRAPPHPASTESYLLRGPPS
MSEFIHGHRLSKEKRLTVAIPDCQQPAASIPPHGSQLARGPDCQTVSPNALPEEQPHSSS
QCAPLNCLSKPPPYP
Download sequence
Identical sequences H0ZML5
59729.ENSTGUP00000011838 ENSTGUP00000011838 ENSTGUP00000011838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]