SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012094 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012094
Domain Number 1 Region: 780-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000578
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 830-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 3 Region: 722-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000206
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 250-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000565
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 5 Region: 377-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family Laminin-type module 0.063
Further Details:      
 
Domain Number 6 Region: 58-155
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000272
Family APC10-like 0.084
Further Details:      
 
Domain Number 7 Region: 448-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 307-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012094
Domain Number - Region: 686-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012094   Gene: ENSTGUG00000011732   Transcript: ENSTGUT00000012228
Sequence length 881
Comment pep:known chromosome:taeGut3.2.4:3:60505450:60634350:-1 gene:ENSTGUG00000011732 transcript:ENSTGUT00000012228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAVLNLASNALITTNATCGEKGREMYCKLVEHVPGQPARNPQCRICDQRSRVPHQRH
PIANAIDGKNTWWQSPSIQNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERS
LDGVDYQPWQYYAITDSECLTRYNIHPRPGTPSYIKDDEVICTSYYSKIHPLENGEIHTS
LINGRPSADDPSRELLEFTSARFIRLRFQRIRTLNADLMMFAHKDPAEIDPIVTRRYYYS
IKDISVGGMCICSGHAKACPLDPMTNKSVCQCEHNTCGETCDQCCPGFHQKPWHAGTLLH
KHECEPCNCHGKTEECYYDQDVADRNQSLNIHGEFLGGGVCVNCSGYTSGINCETCLDGY
FRPKGVLPENPDPCQPCSCDPNGSLNDTCVKDEKHTEGDLLPGFCHCKTGYAGESCNRCA
LGYTGYPECLPCNCSLEGSENDDPCIGPCICKEHVEGENCDRCKPGFFNLQQNNPEGCEE
CFCSGKTNICRHSPFTYRSIEDMNGWYLTDLPGHIRVIPTQKRFDGHQHLSISNVAAQKV
LPQIYYWSAPSSYLGNKVTAAGGHLKFTVSYDVTEEEEEETSKLMVQSDVIIEGGDLKIS
TPKGIIHLQPSEEHTEEILLKPESFSVHGTDVPVSRREFMTILANVKRILIRATYSNGMN
AIYRLRSVIMESADHTSRGRRVASAVELCECPPGYDGTSCESCWPRHRRVNGTIFGGVCA
PCTCFGHADVCDDITGACLDCKHNTGGPYCDRCLPGFYGDATKGTAEDCQLCACPLNIPS
NNFSPTCHFDRHRGLMCDECPAGYVGPRCERCAEGYFGQPLIPGGSCQPCQCNDNLDFSV
PGSCDSLSGACLICKPGTTGQYCERCADGYFGDALHARNCQ
Download sequence
Identical sequences H0ZNB8
ENSTGUP00000012094 59729.ENSTGUP00000012094 ENSTGUP00000012094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]