SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012223 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012223
Domain Number 1 Region: 1236-1501
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-51
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 504-766
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-48
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 3 Region: 1856-2090
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-46
Family YWTD domain 0.0000211
Further Details:      
 
Domain Number 4 Region: 1551-1808
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-42
Family YWTD domain 0.0000219
Further Details:      
 
Domain Number 5 Region: 2991-3246
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-42
Family YWTD domain 0.0000169
Further Details:      
 
Domain Number 6 Region: 179-423
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-39
Family YWTD domain 0.0000592
Further Details:      
 
Domain Number 7 Region: 2166-2432
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-30
Family YWTD domain 0.0000968
Further Details:      
 
Domain Number 8 Region: 3880-4141
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-29
Family YWTD domain 0.0000592
Further Details:      
 
Domain Number 9 Region: 2893-2983,3239-3300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-22
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1139-1228,1502-1546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000275
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 895-934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 980-1016
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00028
Further Details:      
 
Domain Number 13 Region: 854-896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 14 Region: 816-856
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 15 Region: 3607-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 16 Region: 3327-3367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 3733-3772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 3451-3487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 19 Region: 2866-2907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 3568-3605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 2735-2771
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 22 Region: 3649-3693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 23 Region: 2655-2692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 3411-3447
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 25 Region: 1028-1064
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 26 Region: 2778-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 3291-3325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 3529-3564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 2521-2562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 30 Region: 3370-3407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 2695-2738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 32 Region: 129-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 33 Region: 2815-2855
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 34 Region: 3485-3525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 35 Region: 2566-2606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 939-979
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 37 Region: 1810-1860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000768
Family EGF-type module 0.016
Further Details:      
 
Domain Number 38 Region: 6-65,93-169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000926
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 39 Region: 3779-3858
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000151
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 40 Region: 1071-1108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 41 Region: 2485-2523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 42 Region: 1110-1146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 43 Region: 2615-2651
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 44 Region: 4370-4404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000847
Family EGF-type module 0.035
Further Details:      
 
Domain Number 45 Region: 2120-2169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000155
Family EGF-type module 0.015
Further Details:      
 
Domain Number 46 Region: 3695-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 47 Region: 4264-4299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000029
Family EGF-type module 0.028
Further Details:      
 
Domain Number 48 Region: 449-490,760-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000033
Family Growth factor receptor domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012223
Domain Number - Region: 4228-4264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4191-4226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000542
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 4301-4333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0365
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012223   Gene: ENSTGUG00000011849   Transcript: ENSTGUT00000012357
Sequence length 4575
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:34499558:34981031:-1 gene:ENSTGUG00000011849 transcript:ENSTGUT00000012357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEHPLCDVGEFLCHDGITCVSWHWLCDGEPDCPDDSDESLDTCPEESDFKCSPNFISCIG
TNKCIHLSQLCNGVYDCSDGYDEGVHCRELLPRCQQMNCQHRCAITRNGTRCYCRDGYET
SGDGRSCTDVNECDMYGSCSQMCVNTDGSYTCSCVEGYVLQPDNKSCKAKNKPADRPPLL
LVASPEMIEVLYLNGSRMSAWSPGKGSAVVTLDCSHGGDSLCWVESRDLSSQLKCSRIPK
AATSPEEWAVSIAQNLHNVQQIAMDWITGNFYFVDHVSGRIFVCSQNGSVCVTLIELDLS
NPRAIAVDPTSGKLFFTDYGNAAKVERCDMDGTNRTWIVDSKIEQPTALALDLINKYVYW
LDIYLETVEVVDYQGRRRQTITKGRQIRHLSGLAVFENYLYTINSDNLSILRIDRYNGTD
VQALARLDNAKEIRVYQKRTQAAARSHACEPDPSGTPGGCSHICLLGSSHKARTCRCRTG
FILATDGRSCKRPKNELFLFYGKGRPGIIRGMDLNTKMSDEYMIPIENLVNPRALDFHAE
SNYIYFADTTSFLIGRQKIDGTERETILKDDLDNVEGIAVDWIGNNLYWTNDGHRKTIAV
ARLEKAAQSRKTLLEGDMSHPRGIVVDPVNGWMYWTDWEEDEIDASVGRIEKAWMDGYSR
QVFVTSKMLWPNGLTLDYRANVLYWCDAYYDHIERIYLNGTDRKVVYNGKDLNHPFGLSH
HGNYIYWTDYMNGSIFQLDLVTRNVTLLRSERPPLFGLQIYDPRKQQGDNACRVNNGGCS
TLCLAIPGGRVCACADNQLLEENSTTCTIKEGEVLPQLCKAEQFQCSNKRCIQERWRCDG
DDDCLDGSDEHSEICFNHSCPDDQFKCQNNRCIPKRWLCDGANDCGNNEDESNKTCAART
CQVNQFSCGNGRCIPTSWLCDREDDCGDGTDEMTSCEFPTCEPLTQFICRNGRCISSKWL
CDSGKYDDCGDGSDELGCVHSCSADQFRCQNGRCIPGHWACDGDNDCGDFSDETKTNCSR
EETPSPGRCSGREFQCSPDGSCVPELWRCDGEKDCEDGSDEKGCNGTLRACDEKTKFSCK
STGRCISKAWLCDGDIDCEDQSDEDNCEGYLCGPPKYPCANDTSICLQPEKLCNGRRDCP
DGSDEGDLCDECSLNNGGCSHQCSVVPGGRIVCSCPAGFNLTTDNKTCEIMDYCSKHLKC
SQVCEQHKNTVKCSCYEGWKLSKDGESCVSTDPFEAFIIFSIRHEIRKIDLHKRDYSLLV
PGLRNTIALDFHFSQSLLYWTDVVEDKIYRGKLSDTGGVSAIEVVVQHGLATPEGLTVDW
IAGNIYWIDSNLDQIEVAKLDGTLRTTLIAGAMEHPRAIALDPRYGILFWTDWDANFPRI
ESASMSGAERKIIYKDMDTGAWPNGLTVDHFEKRIVWTDARSDAIYSALYDGTSMIEIIR
GHEYLSHPFAVSLYGSEVYWTDWRTNTLAKANKWTGQNVSVIQKTSAQPFDLQIYHPSRQ
PQAPNPCSANEGRGPCSHMCLINHNRSAACACPHLMKLSSDKKTCYERKKFLLYARRSEI
RGVDIENPYFNFITAFTVPDIDDVTVIDFDAVEERLYWTDVKTQTIKRAFINGTGLETII
SRDIQSIRGLAVDWISRNLYWISSEFDETQINVAHLDGSLKTSIIHGIDKPQCLAVHPVK
GKLYWTDGNTINMANMDGSNSKILFQNQKDPVGLSIDYGENKLYWISSGNGTISRCNLDG
GNLEIIESMKEELTKATALTIMDKKLWWADQNLAQIGTCNKKDGRNPTVLRNKTAGVVHM
KVYDKAAQQGSNSCQLNNGGCSQLCLPTSETTRTCVCTVGYNLQKNRMACKGIESFLMYS
VHEGIRGIPLDPNDKMDALMPISGASFAVGIDFHAGNDTIYWTDMGFNKISRAKRDQTWK
EDIVTNGLGRVEGIAVDWIAGNIYWTDHGFNLIEVARLNGSFRYVVISQGLDQPRSIAVH
PEKGYLFWTEWGQSPCIGRAHLDGSEKVVLVSLGIAWPNGISIDYEENKLYWCDARTDKI
ERIDLESGGSREIVLSGSNVDMFSVAVFGAYIYWSDRAHANGSIRRGHKNEATDAVTMRT
GLGINLKEVKIFNRAREKGTNVCAKNNGGCHQLCLYRGSARRTCACAHGYLAEDGISCLR
HEGYLLYSGRTILKSIHLSDESNLNSPVMPYENPEYFKNVIALAFDYSLKGRGTNRIFFS
DAHYGNIQVIKDNWAGRKVLIENVGSVEGLAYHRAWDTLYWTSSTTSSITRHSVDQRRRG
AFNREAVITMAEDDHPHVLALDECQNLMFWTNWNEQLPSIMRSTLSGKNAHVIISTDILT
PNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRYVIVKSGPGTFLSLAVYDEYIFWSDGV
RRAILRSSKYTGGDTKVLRSDIPHQPMGIIAVANDTNSCELSPCAQMNGGCHDLCLLTPD
GRVNCSCRGDRVLIDDNRCVSKNSTCNIYSEFECGNGECIDYQLTCDGIAHCKDKSDEKL
FYCENRGCRKGFKPCSNRRCVPSDKVCDGANDCGDNSDEFDCKDSACAPAEFRCADGVCV
GKSAQCNQIIDCADASDEKNCNNTNCAYFYKLGIKSSGFISCNSTSLCILPEWICDGSND
CGDYTDELKCPVQNKPTCEENYFGCPSGRCILTTWLCDGQKDCEDGVDELHCDSSCSWNQ
FACSANKCISKQWTCDGEDDCGDGLDESDAVCGSVTCAADTFSCLGSHACVPQHWLCDGE
RDCPNGSDELSTAGCAPNNTCDENAFMCHNKVCIPKQFVCDHDDDCGDGSDESLECGYRR
CRPGEFTCADGRCLLNSQWQCDGDFDCPDHSDEAPINAKCKSSEQSCNSSFFMCKNGKCI
PQSEVCDKKEDCSDGSDEKSCHINECLSKKVSGCSQDCQDLPVGYKCKCWPGFLLKDDGK
TCVDIDECSSGFPCSQQCINTYGTYKCLCAEGYETQPDNPNGCKSLSDEEPFLILADHHE
IRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSSRPNGSRINRMSLNGSDIKVVH
NTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTVLVSKRVKFPRDLSLDPQAGYL
YWIDCCESPHIGRVGMDGSRQSVVIETQISRPMALTIDYVNHRLYWADENHIEFSDMDGS
HRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTSGSDRLSLINSWHTITDIQVY
HSYRQPDVSRHVCTLNNGGCSHLCLLAPDQLHSCACPTNFYLAADNRTCLSNCTASQFRC
KTDKCIPFWWKCDTVDDCGDGSDEPAECPEFRCQPGRFQCGTGLCALPAFICDGENDCGD
NSDELNCDTHVCLSGQFKCTKNQKCIPINLRCNGQDDCGDEEDERDCPENSCSPDHFQCK
TTKHCISKLWVCDEDPDCADGSDEANCDKKTCGPHEFQCKNNNCIPDHWRCDSQNDCGDN
SDEENCKPQTCTLKDFPCANGDCVSARFWCDGDYDCADGSDERYCETGCSRDQFQCSNGQ
CISAKWKCDGHEDCKLGDDEKNCEPASPTCSSSEYVCASGGCISASLKCNGELDCADGSD
EMDCVAECKEDQFRCRNKAYCIPVRWLCDGIHDCVDGSDEENCDQGGNICRADEFLCNNS
LCKLHFWVCDGEDDCGDNSDEVAEMCVKFPCPPTRPYRCRNNRVCLRPEQICNEVDDCGD
NSDEDHCGNKITYKARPCKKDEFACNNKKCIPMELQCDWFDDCGDGSDEQDCKISIAEYT
CEDNVNPCGDDAFCNQTKSSLLCQCKPGFQRNRRNRQCEDINECMVFGTCSQHCHNLKGS
YRCACEKNYKEKNNSCIAKGSEDQVLYVANDTDILGFAYPFNYSDAHQQISHIEHNSRIT
GMDAYFQGDMIVWSTQFNPGGIFYRKLHDRERRQSNSGLICPEFKRPRGIAVDWVAGNIY
WTDHSRMHWFSYYTTHWTSLRYSINVGQLKGPNCTRLLTSIAGEPYAIAVNPKKGMMYWT
VIGDRSHIEESSMDGTLRRILVQKNLQRPTGLVVDQFSQRLFWADFELSVIGSVLFDGSD
SVVSVSTKQGLLHPHRIDIFEDYIYGAGPKNGAFRVHKFGKSLVEYLGVDVDKAKSALIL
HRYKQTDLPNPCLDLTCEFICLLNPSGATCACPEGKALMNGTCIDQSLLDDSCKLTCENG
GKCIINEKGDARCHCWPSYSGERCETNHCYNYCQNGGTCGASLLGRPTCSCALGFTGPRC
NQTVCERFCQNGGTCSVTAGNQPFCACLPEYTGDRCQYYVCHHYCVNSESCTISEDGRVE
CVCPARFEGPKCEVDKCTRCHGGHCITSKDSSDVVCNCTNGKIASTCQLCDGYCYNGGTC
QLDPETNIPVCICSANWSGTQCERPAPKSSKSDNISTRSIAIIVPLVLLVTLITTLVIGL
FLCKRKRRTKTIRRQPMINGGINVEIGNPSYNMYEVGHDHSEGGLLASDFTLNAEKARYI
GGGSTAFKLPHTAPSIYLNSDLKGPLSTGPTNYANPVYAKLYVDGQNCRNSLASVDERRE
LLPKKIDIGIRETVA
Download sequence
Identical sequences H0ZNP6
ENSTGUP00000012223 59729.ENSTGUP00000012223 ENSTGUP00000012223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]