SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012350 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012350
Domain Number 1 Region: 1630-1817
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.86e-35
Family Laminin G-like module 0.00052
Further Details:      
 
Domain Number 2 Region: 1452-1629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-33
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 1041-1223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.56e-23
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 1230-1399
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.53e-21
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 5 Region: 828-1023
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-18
Family Laminin G-like module 0.0098
Further Details:      
 
Domain Number 6 Region: 189-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000248
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 7 Region: 145-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 8 Region: 84-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 368-569
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000178
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012350   Gene: ENSTGUG00000011973   Transcript: ENSTGUT00000012487
Sequence length 1818
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:67883797:67982901:1 gene:ENSTGUG00000011973 transcript:ENSTGUT00000012487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALISAWPLVSPVFFFLRCFSSSTASSEGSVFQFDIEGSSAVSTQEATVIRGQQQAVATG
SWVPFAERCQEGFYRTSSGKCSPCNCNGNANRCLDGSGICVNCQRNTTGQHCEQCPDGFI
GDVVRGAPTFCQPCPCPLPELANFAVSCYRKSGSVHCVCRENYAGPNCERCAPGYYGNPL
LIGSTCKKCDCNGNSDPNLIFEDCDEVTGQCRNCLHHTSGFKCERCAPGYYGDARLAKNC
TACNCGGRMCDSQTGECLADMCEYTQCCDKCIWDLTDDIRLSVLTIDESKSTLLSISTGV
AAQRRLNDLNLTATHLQVQTLMAFQFFHVRRSLFSNALTWTSMCSPGESKICGNEASSKG
RLVQKETTEINNRASQLVQQLNDIRDNIEEISSKSKYYAIQQELSPEEIAQKRSMAEEML
KEIKHRNPFTNQRQLADEEENAAEELLQQIEAFHEKYNDTRSLVTDVLEQLSEQDVKLSD
LEEALGEALDYVTQTEDINRENTARLQRQEKQHEKTKEQMDEVNSILLSATTILEGPQKV
NSELSEVIKNASGFYAEIDGAKKELQEKIANLSLFDDDLVEKAMHHAQNLRRLSDELDGN
LYGVDSNGLVQRAINASNVYENIAGYIEEANEIASLALNTTNRVKDAAVGIDTQVIYHKG
KSEELLIRAMQLQRTAHDSSGYTIADTSWQVNGSFARMNALRSQLMRAIAKMQSAETVEA
RERLEQAQLETAEAVSTTTTVTQATTPMDENVRLWSQNLQDFQHNSEAFDSAVHSAGDAV
KKLTEVFPQLLDKMRRVEQKAPANNISSSIQRIRELIAQTRSVASKVQVSMMFEGQSAVE
VNPKINVEELKSFTSMSLYIKLHKDNPQLAASPDRFVLYLGNKNAKHYIGLAIKNDNLVY
IYNLGGQDVEIPLDAKPVSTWPSHFSIIKIERIGRHGKMFLTVPSLSSTAEEKFIKKGEV
LGPGSLLNLEPENAVFYVGGVPPGFKLPPSLNLPGFIGCLELATLNDDVISLYNFKHVYN
IDTTTSPPCARDKLAFTQSRAVSYFFDGSGYALARNIERRGKFSQVTRFDIEVRTPTDNG
LILLMINGSMFFSLEMHNGFLYLRYDFGFSNGPILLEDSMKKARINDAKFHEISIIYHNS
KKMILVVDRRHIKSVDNERTAMPFTDIYIGGAPADILHSRLFYSHLAGSIGFKGCMKGFQ
FQKKDFNLLEEPGTLGISYGCPEDSLMSRNAYFNGESFIASSQKVSLFTEFEGGFNFRTL
QPSGLLFYYSEGSDILSISMERGAVVLNASGTKIQSPDRNYNDGKTHFIITSVTPERYEL
TVDDKKQSKKNPAKDRAGKSPDSIKKFYFGGSPLRTQQANFTGCISNAYFTRLDQEVEVE
DFQKYSEKVQASLYGCPVESPPVALIHKKGKNSSKAKGNHNKKVGRDKDKISQPSSGLKK
LYQVNLQREPQCHLPMNPKATEHAYQFGGTANSRQEFDHIPKDFSQRAQFSISLKTHSSH
GMICYISDQKETNFMALFVAHGRLIFMFNAGHQKIRIKSQEKYNDGRWHNVIFIRGKNIG
RLIIDGLRVLEESFDGNANSWQVTKPLYIGGVAPGKAVKNIQINSVYSFSGCLSNLQLNG
RSLTSASQTFSVTPCFEGPSEAGTYFSSEGGYVVLDESFSLGLKFEVVFEIRPRSSSGIL
LHGHSVNGEYLNMHMRNGQVTVKLNNGIRDFSTSVTLKQSLCDGRWHRIAVIRDANVVQL
DVDSEVNHVVGPLNPKATDHREPVFIGGVPESLLTSSLTTRNSFIGCIRNFMIDEKPVSF
SKAALVSGAVSINTCPAA
Download sequence
Identical sequences H0ZP21
ENSTGUP00000012350 ENSTGUP00000012350 59729.ENSTGUP00000012350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]