SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012721 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012721
Domain Number 1 Region: 206-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-39
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 846-1025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 443-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-36
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 651-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 25-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-30
Family Laminin G-like module 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012721
Domain Number - Region: 1051-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012721   Gene: ENSTGUG00000012355   Transcript: ENSTGUT00000012864
Sequence length 1087
Comment pep:known chromosome:taeGut3.2.4:5:39895138:40301850:1 gene:ENSTGUG00000012355 transcript:ENSTGUT00000012864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFTLHSIYFTLKVSLLLGSLLGLCLGLEFMGIPNQWARYLRWDASTRSELSFQFKTNVS
AGLLLYFDDGGVCDFLCVSLVDGRIQLQFSVDCAETTVVTDKQVNDSSWHFLMVSRNHLR
TVLVLDGEAKPGEVRPQRQYMNIVSDLFIGGVPLDIRPAALTLDGVLSEPPFQGFILDLK
YGNSEPQLLGSQGVRLEMEGLCSENPCENGGTCFLLDGEPHCDCSATGYAGKLCSEVSLS
LSGLSHLMMSEQARDENMATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIGDTKMKIYGEVKFICENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDTRSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCSRLSTKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYG
LLMATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNASKGPETLYAGQKLNDNEWHTVR
VVRRGKSLKLIVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVIPSSFIGHLQSLMF
NGMLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFK
TTSADGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVIT
RDNSNTHSLKVDTKVVTQVINGAKNLDLKGDLYIAGLAQGMYSNLPKLVASRDGFQGCLA
SVDLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGICNQQWEGFTCDCSMTSY
SGSQCND
Download sequence
Identical sequences H0ZQ35
59729.ENSTGUP00000012721 ENSTGUP00000012721 ENSTGUP00000012721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]